Recombinant Shigella dysenteriae serotype 1 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; SDY_1307; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWKPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLFHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: sdy:SDY_1307

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin and what role does it play in Shigella pathogenesis?

Cardiolipin is an anionic phospholipid that primarily resides at the poles of both the inner and outer membranes of Shigella species. Research on Shigella flexneri has demonstrated that cardiolipin plays a dual essential role in pathogenesis. In the inner membrane, cardiolipin is required for proper cell division during intracellular growth, while in the outer membrane, it facilitates the proper presentation of IcsA (a key virulence factor) on the bacterial surface . When cardiolipin synthesis is disrupted, Shigella cannot form plaques in epithelial cell monolayers, indicating a critical function in virulence . This phospholipid's importance is underscored by the finding that Shigella mutants lacking cardiolipin can grow normally in vitro and invade host cells but fail to spread efficiently between cells, a critical step in the infection process .

How many cardiolipin synthase genes have been identified in Shigella species?

Three distinct cardiolipin synthase genes have been identified in Shigella based on research in related Enterobacteriaceae. These are designated as clsA (previously known as cls), clsB (previously ybhO), and clsC (previously ymdC) . Studies in Escherichia coli, which shares high genetic similarity with Shigella, have confirmed that all three genes encode functional cardiolipin synthases that belong to the phospholipase D superfamily . The presence of multiple cardiolipin synthases suggests functional redundancy but also potential specialization, as their expression and activity vary depending on growth phase and environmental conditions . Only when all three genes are deleted does a complete absence of cardiolipin occur in the bacterial membrane .

What are the distinct functions of each cardiolipin synthase in Shigella?

ClsA serves as the primary cardiolipin synthase during logarithmic growth phase, particularly under standard laboratory conditions with lower osmolarity. Research shows that ClsA is responsible for virtually all detectible cardiolipin synthesis (approximately 5% of phospholipids) during active growth . ClsB contributes minimal cardiolipin during logarithmic growth but becomes significantly active during stationary phase, where it can compensate for the loss of ClsA . ClsC, especially when co-expressed with YmdB, primarily functions during stationary phase and under high osmolarity conditions . Interestingly, ClsC utilizes a distinct biochemical mechanism for cardiolipin synthesis compared to ClsA and ClsB, employing phosphatidylethanolamine rather than phosphatidylglycerol as the phosphatidyl donor to form cardiolipin . This functional specialization suggests that different cardiolipin synthases may respond to specific environmental cues encountered during infection.

How does cardiolipin distribution affect Shigella membrane function?

Cardiolipin exhibits a specialized distribution pattern in Shigella, concentrating at the bacterial poles in both the inner and outer membranes. This distribution is crucial for proper membrane function and virulence . The transport of cardiolipin from the inner to the outer membrane is mediated by PbgA, a dedicated transporter protein . When this transport is disrupted in a pbgA mutant, cardiolipin remains present in the inner membrane but is absent from the outer membrane . This specific absence from the outer membrane prevents proper localization of the actin polymerization protein IcsA on the bacterial surface, which in turn inhibits the ability of Shigella to spread between host cells . Additionally, proper cardiolipin distribution in the inner membrane is essential for cell division during intracellular growth, as evidenced by the filamentous phenotype observed in clsA mutants during infection .

How do the three cardiolipin synthases differ in their catalytic mechanisms?

The three cardiolipin synthases in Shigella utilize distinctly different catalytic mechanisms to synthesize cardiolipin. ClsA and ClsB both catalyze the condensation of two phosphatidylglycerol (PG) molecules to form cardiolipin and glycerol . This represents the classical pathway for cardiolipin synthesis in most bacteria. In contrast, ClsC employs a fundamentally different mechanism when co-expressed with its neighboring gene product, YmdB . In vitro assays using synthetic phospholipids with unnatural fatty acid compositions have revealed that the YmdB-ClsC complex uses phosphatidylethanolamine (PE) as the phosphatidyl donor to phosphatidylglycerol to form cardiolipin . This represents a third and unique mode for cardiolipin synthesis distinct from both the bacterial PG-condensation mechanism and the eukaryotic pathway (which uses PG and CDP-diacylglycerol as substrates) . The discovery of this alternative synthesis pathway suggests that Shigella can maintain cardiolipin levels under diverse environmental conditions through metabolic flexibility.

What techniques can be used to accurately measure cardiolipin levels in Shigella membranes?

Several complementary techniques are essential for accurate cardiolipin quantification in Shigella research:

TechniqueApplicationAdvantagesLimitations
Thin Layer Chromatography (TLC) with [³²P]PO₄Quantitative detection of cardiolipinAllows quantification of relative phospholipid levelsLimited specificity for closely related lipids
Two-dimensional TLCSeparation of phospholipids with similar mobilityImproved resolution of lipid speciesMore time-consuming than standard TLC
Liquid Chromatography/Mass Spectrometry (LC/MS)Precise identification of cardiolipin speciesProvides molecular-level characterizationRequires specialized equipment
Multiple Reaction Monitoring (MRM)Detection of specific cardiolipin molecular speciesHighly specific for target moleculesRequires prior knowledge of expected masses
Bligh-Dyer extractionPreparation of total membrane lipidsStandard method for complete lipid extractionMay co-extract non-lipid contaminants

For comprehensive analysis, researchers typically employ radiolabeled TLC for initial quantification, followed by LC/MS/MS for detailed molecular characterization . When analyzing cardiolipin in specific membrane fractions (inner versus outer), additional membrane separation techniques must be employed before lipid extraction. The combination of these methods allows for both quantitative and qualitative assessment of cardiolipin levels and species distribution in response to genetic manipulations or environmental conditions .

How can one create and validate cardiolipin synthase mutants in Shigella?

Creating and validating cardiolipin synthase mutants in Shigella requires a systematic approach:

  • Gene deletion strategy: Use lambda Red recombinase-based systems to replace the target cls gene with an antibiotic resistance marker. For studying complete cardiolipin deficiency, all three cls genes (clsA, clsB, and clsC) must be deleted sequentially .

  • Complementation testing: Confirm the specificity of mutation effects by expressing the wild-type gene from a plasmid (such as arabinose-inducible pBAD30 vector) in the mutant background .

  • Lipid analysis validation: Perform comprehensive lipid analysis using both TLC and mass spectrometry to confirm the absence or reduction of cardiolipin and analyze potential compensatory changes in other phospholipids .

  • Growth phase considerations: Examine phospholipid composition in both logarithmic and stationary growth phases, as different cls genes contribute differentially depending on growth phase .

  • Functional validation: Assess phenotypes related to membrane function and virulence, including:

    • Plaque formation in epithelial cell monolayers

    • Invasion efficiency

    • Intracellular replication rates

    • Cell-to-cell spread capabilities

    • IcsA localization using immunofluorescence microscopy

Proper validation must include control strains and quantitative measurements of both lipid composition and virulence-related phenotypes to establish causality between cardiolipin deficiency and observed functional defects.

What cell culture models are appropriate for studying the role of cardiolipin in Shigella pathogenesis?

Several cell culture models are valuable for investigating cardiolipin's role in Shigella pathogenesis:

Model SystemApplicationKey Measurements
Epithelial cell monolayersPlaque formation assayQuantification of plaque number and size after 72 hours
Cultured epithelial cells (e.g., HeLa)Invasion assayPercent invasion compared to wild-type
Infected epithelial cellsIntracellular replicationBacterial doubling time at 60 and 180 minutes post-infection
Infected cell immunofluorescenceIcsA localizationVisualization of IcsA distribution on bacterial surface
Live cell microscopyIntracellular motilityAssessment of bacterial movement and filamentation

The plaque formation assay is particularly informative as it integrates multiple aspects of pathogenesis: invasion, replication, and cell-to-cell spread . For detailed mechanistic studies, researchers should isolate intracellular bacteria at defined timepoints post-infection (60 and 180 minutes) to assess growth rates and morphological changes . Combining these approaches provides comprehensive insights into how cardiolipin deficiency affects different stages of Shigella's intracellular lifecycle. When using these models, it's important to consider growth conditions prior to infection, as pre-exposure to deoxycholate (DOC) has been shown to increase virulence protein secretion and infectivity of wild-type Shigella .

How can researchers distinguish between the effects of cardiolipin on inner versus outer membrane functions?

Distinguishing between inner and outer membrane cardiolipin functions requires specialized approaches:

  • Strategic mutant comparison: Compare phenotypes of clsA mutants (lacking cardiolipin in both membranes) with pbgA mutants (lacking cardiolipin specifically in the outer membrane while maintaining normal inner membrane cardiolipin) .

  • Membrane fractionation: Physically separate inner and outer membranes using density gradient centrifugation before lipid extraction and analysis to quantify cardiolipin content in each membrane compartment .

  • Phenotypic analysis pipeline:

    • Cell division defects (filamentation) primarily indicate inner membrane dysfunction

    • IcsA localization defects specifically reflect outer membrane dysfunction

    • Plaque formation assays integrate both aspects of membrane function

  • Compensatory lipid analysis: Analyze changes in other phospholipids (especially phosphatidylglycerol) in each membrane fraction, as these may compensate differently depending on the membrane compartment .

  • Protein localization studies: Use fluorescent protein fusions or immunofluorescence microscopy to track the localization of membrane proteins known to interact with cardiolipin in each membrane compartment .

This multi-faceted approach allows researchers to parse the distinct contributions of cardiolipin to inner membrane functions (primarily cell division) versus outer membrane functions (protein localization and presentation) in Shigella pathogenesis .

What expression systems are most effective for producing recombinant Shigella cardiolipin synthase?

Selecting the appropriate expression system for recombinant cardiolipin synthase is critical for obtaining functional protein:

Expression SystemAdvantagesConsiderations
pBAD arabinose-inducible vectorTitratable expression control; demonstrated functionality for all three cls genesRequires careful optimization of arabinose concentration (0.05-0.2% typically optimal)
Dual-plasmid systemsAllows co-expression of interacting partners (e.g., ClsC with YmdB)Requires compatible origins of replication and selection markers
Native promoter constructsMaintains physiological regulationMay result in low expression levels unless native regulatory elements are modified
T7-based expression systemsHigh-level protein productionMay lead to inclusion body formation requiring refolding

When expressing cardiolipin synthases, it's particularly important to consider membrane protein expression challenges. For ClsC, successful expression and activity require co-expression with YmdB, either from the same operon or from compatible plasmids . Expression levels should be carefully monitored, as overexpression of membrane proteins can lead to toxicity or misfolding. For functional studies, complementation of the appropriate cls deletion mutant provides the most reliable indication of properly folded, active protein .

What are the critical factors for maintaining cardiolipin synthase activity during purification?

Preserving cardiolipin synthase activity during purification requires careful attention to multiple factors:

  • Membrane preparation: The membrane fraction containing overexpressed cardiolipin synthase provides the most reliable source of active enzyme for in vitro assays . Complete cell disruption followed by differential centrifugation is typically employed to isolate membrane fractions.

  • Detergent selection: When purifying cardiolipin synthase away from membranes, detergent choice is critical. Mild non-ionic detergents (e.g., DDM, CHAPS) at concentrations just above their critical micelle concentration help maintain the native fold of membrane proteins.

  • Buffer composition:

    • pH: Maintain pH 7.0-8.0 for optimal stability

    • Salt concentration: 150-300 mM NaCl typically provides stability without disrupting protein-lipid interactions

    • Glycerol (10-20%): Enhances protein stability during storage

    • Reducing agents: Include to prevent oxidation of cysteine residues

  • Temperature considerations: Perform all purification steps at 4°C to minimize proteolysis and denaturation.

  • Activity assays: Use synthetic phospholipids with distinct fatty acid compositions to track specific activity . The ability to detect the formation of cardiolipin species with specific fatty acid compositions using LC/MS/MS provides a sensitive and specific measure of enzyme activity .

For ClsC specifically, maintaining association with YmdB is essential for robust activity, suggesting that co-purification approaches may be necessary for obtaining fully functional enzyme .

How can cardiolipin synthase research contribute to antimicrobial development?

Cardiolipin synthase represents a promising antimicrobial target for several compelling reasons:

  • Essentiality for virulence: While cardiolipin synthase mutation doesn't affect bacterial growth in vitro, it dramatically impairs virulence in cell culture models, suggesting that targeting it could specifically inhibit pathogenesis without creating strong selection pressure for resistance .

  • Multiple targeting opportunities: The transport of cardiolipin from inner to outer membrane by PbgA offers an additional target in the same pathway, potentially allowing for synergistic therapeutic approaches .

  • Pathogen specificity: The discovery of the unique PE-dependent cardiolipin synthesis mechanism by ClsC-YmdB offers potential opportunities for developing inhibitors specific to this bacterial pathway without affecting human lipid metabolism .

  • Conservation across pathogens: The importance of cardiolipin for the virulence of Shigella suggests that this pathway may be similarly important in related enteric pathogens, potentially allowing for broad-spectrum applications of developed inhibitors.

The critical need for new antimicrobial approaches against Shigella is highlighted by the fact that worldwide, Shigella species infect hundreds of millions of people annually, with fatality rates up to 15% . Traditional antibiotic treatment is increasingly compromised by rising antibiotic resistance, and no approved vaccine exists to prevent these infections . Cardiolipin synthesis inhibitors could represent a novel class of anti-virulence compounds that specifically target the pathogenesis process rather than bacterial growth.

What are the most promising directions for future cardiolipin synthase research?

Several high-priority research directions emerge from current knowledge about cardiolipin synthase in Shigella:

  • Structural biology: Determining the crystal or cryo-EM structures of all three cardiolipin synthases would provide critical insights for rational drug design and understanding the different catalytic mechanisms.

  • Regulatory networks: Investigating how cardiolipin synthesis is regulated in response to environmental stimuli encountered during infection could reveal new regulatory targets and therapeutic approaches.

  • Host-pathogen interface: Exploring how cardiolipin influences interactions between Shigella and host cell membranes during invasion and cell-to-cell spread could uncover additional roles beyond IcsA localization.

  • Comparative studies: Extending findings from S. flexneri to other Shigella species, particularly S. dysenteriae serotype 1, which produces Shiga toxin and causes the most severe disease.

  • In vivo models: Moving beyond cell culture to animal infection models to validate the importance of cardiolipin synthesis in complex host environments.

  • Inhibitor development: Designing and screening for small molecule inhibitors that specifically target ClsA, which appears to be the most critical cardiolipin synthase for virulence, or the unique ClsC-YmdB system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.