Recombinant Shigella dysenteriae serotype 1 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced via recombinant DNA technology in E. coli, followed by affinity chromatography using nickel-NTA resin. Critical steps include:

  • Lyophilization: Stabilized with 6% trehalose (pH 8.0) to prevent aggregation .

  • Quality Control: Validated by Western blot and enzymatic activity assays .

Comparative Analysis with Homologs

CobS orthologs exist across Shigella species and other Enterobacteriaceae. Functional conservation is observed despite sequence variability:

Table 2: CobS Comparison Across Bacterial Species

SpeciesUniProt IDLength (aa)Identity to S. dysenteriae cobS
S. dysenteriae serotype 1Q32ED1247100%
S. flexneriA0A0H2V3G924792%
Salmonella newportB4SWC624785%

Pathogen Metabolism Studies

  • CobS is essential for cobalamin-dependent pathways in Shigella, including methionine synthesis and redox balance .

  • Knockout mutants show reduced virulence in gut colonization models, suggesting cobS as a therapeutic target .

Vaccine Development

  • Recombinant cobS has been evaluated as a subunit vaccine candidate due to its surface exposure in Shigella .

  • In murine models, cobS antibodies reduced bacterial load by 70% in challenged subjects .

Antimicrobial Resistance (AMR)

  • CobS is not directly linked to AMR but coexists with resistance plasmids in extensively drug-resistant (XDR) Shigella strains .

Challenges and Future Directions

  • Stability Issues: Requires strict storage at -80°C to retain activity .

  • Structural Studies: Cryo-EM or crystallography data are needed to resolve its mechanism of adenosyl transfer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; SDY_2241; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGIAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: sdy:SDY_2241

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its role in Shigella dysenteriae?

Cobalamin synthase (cobS) is an enzyme involved in the biosynthesis of cobalamin (vitamin B12) in Shigella dysenteriae serotype 1. The protein is encoded by the cobS gene (locus tag SDY_2241) and plays a critical role in the assembly of the corrin ring structure of cobalamin . Functionally, cobS catalyzes one of the final steps in cobalamin biosynthesis, facilitating the attachment of the upper axial ligand to the cobalt center of the corrin ring. This enzyme is essential for the production of functional cobalamin, which serves as a cofactor for several vital metabolic processes including methionine synthesis and DNA metabolism . The mature protein consists of 247 amino acid residues with a complex transmembrane structure featuring multiple membrane-spanning domains that anchor the enzyme within the bacterial cell membrane .

How does the structure of Shigella dysenteriae cobS compare to homologous proteins in other bacteria?

The structure of Shigella dysenteriae serotype 1 cobS shares significant homology with cobalamin synthases from other bacteria, particularly those within the Enterobacteriaceae family. Structurally, the protein contains multiple transmembrane domains with characteristic hydrophobic regions that facilitate membrane integration . Comparative analysis reveals that cobS proteins across different bacterial species maintain a highly conserved catalytic domain while exhibiting variations in their membrane-spanning regions.

When aligned with Escherichia coli cobalamin synthase, the Shigella dysenteriae cobS shows approximately 85-90% sequence identity, with most variations occurring in non-catalytic regions. Key functional residues involved in substrate binding and catalysis are largely conserved across species, suggesting evolutionary pressure to maintain the fundamental catalytic mechanism . The protein's structure includes:

Structural FeatureAmino Acid PositionCharacteristic
Transmembrane Domain 118-38Hydrophobic α-helix
Transmembrane Domain 292-112Hydrophobic α-helix
Transmembrane Domain 3157-177Hydrophobic α-helix
Transmembrane Domain 4202-222Hydrophobic α-helix
Catalytic Domain118-146Highly conserved region

These structural features enable the protein to properly orient within the membrane while positioning the catalytic site to interact with its substrates during cobalamin biosynthesis .

What are the fundamental expression considerations for producing recombinant Shigella dysenteriae cobS?

When planning to express recombinant Shigella dysenteriae serotype 1 cobS, several fundamental considerations must be addressed to ensure successful protein production. First, the selection of an appropriate expression system is critical, with E. coli being the most commonly used host due to its genetic tractability and rapid growth . Specifically, E. coli K-12 W3110 has demonstrated compatibility with Shigella proteins in heterologous expression studies .

Expression conditions require careful optimization, particularly:

  • Induction temperature (typically lowered to 16-25°C to enhance proper folding)

  • Inducer concentration (IPTG typically at 0.1-0.5 mM)

  • Duration of expression (extended periods of 16-24 hours at reduced temperatures)

  • Media composition (supplementation with trace elements that support cobS folding)

Finally, codon optimization for the expression host should be considered, as Shigella dysenteriae and E. coli may have different codon usage preferences that could affect translation efficiency . This is particularly important for membrane proteins like cobS that contain rare codons which might limit expression levels in heterologous systems.

How can researchers optimize heterologous expression of functional cobS protein with proper membrane integration?

Optimizing heterologous expression of Shigella dysenteriae serotype 1 cobS with proper membrane integration requires a sophisticated multi-parameter approach. A critical first step involves selecting specialized expression vectors containing regulatable promoters that allow fine-tuned expression control . The pET system with T7 promoter offers tight regulation through IPTG induction but may lead to excessive expression causing inclusion body formation. Alternatively, the arabinose-inducible pBAD system provides more graduated expression control, which can be advantageous for membrane proteins.

For proper membrane integration, consider using specialized E. coli strains designed for membrane protein expression such as C41(DE3) or C43(DE3), which contain mutations that prevent toxic accumulation of membrane proteins . Additionally, co-expression with chaperones (GroEL/GroES, DnaK/DnaJ) can significantly enhance proper folding and membrane insertion efficiency.

Advanced expression protocols should incorporate a refined induction strategy:

  • Grow cultures at 37°C until mid-log phase (OD600 = 0.6-0.8)

  • Shift temperature to 16-20°C for 30 minutes before induction

  • Add inducer at reduced concentration (0.1 mM IPTG or 0.002% arabinose)

  • Continue expression for 16-20 hours at reduced temperature

  • Monitor membrane fraction for properly integrated cobS using western blotting

Supplementation with specific lipids that match the native Shigella membrane composition can enhance proper folding and integration. Consider adding phosphatidylethanolamine and phosphatidylglycerol to the growth medium at concentrations of 25-50 μg/ml . This biomimetic approach creates a more favorable environment for the integration of cobS into membranes during expression.

What structural analysis techniques are most effective for investigating the membrane-associated domains of cobS?

Investigation of membrane-associated domains of Shigella dysenteriae cobS requires specialized structural analysis techniques that address the challenges of membrane protein characterization. X-ray crystallography, while powerful for soluble proteins, presents significant challenges for membrane proteins like cobS due to difficulties in crystallization . Researchers have overcome similar challenges in related proteins by using lipidic cubic phase crystallization, which provides a membrane-mimetic environment during crystal formation.

Cryo-electron microscopy (cryo-EM) has emerged as a particularly valuable technique for membrane protein structural studies. This approach allows visualization of cobS in a near-native lipid environment without the need for crystal formation . For optimal results, cobS should be purified in mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration.

Complementary techniques that provide valuable structural insights include:

TechniqueApplication to cobSResolution/Information
Hydrogen-deuterium exchange mass spectrometry (HDX-MS)Maps solvent-accessible regions and conformational dynamicsPeptide-level resolution of flexibility and solvent exposure
Solid-state NMRAnalyzes membrane-embedded regions in native-like lipid bilayersAtomic-level information on specific residues within the membrane
Site-directed spin labeling with EPRMeasures distances between specific residues5-80 Å distance measurements for mapping tertiary structure
Molecular dynamics simulationsModels protein-membrane interactionsComputational predictions of membrane insertion and dynamics

These techniques are most powerful when used in combination, providing complementary structural information across different resolution scales . For example, low-resolution models from cryo-EM can be refined using distance constraints from EPR and dynamics information from HDX-MS to construct comprehensive structural models of membrane-integrated cobS.

How does cobS interact with other proteins in the cobalamin biosynthetic pathway, and what methods best elucidate these interactions?

Cobalamin synthase (cobS) functions within a complex network of protein interactions in the cobalamin biosynthetic pathway. Evidence suggests cobS interacts directly with cobT (cobalamin 5′-phosphate synthase) and cobC (cobalamin biosynthesis protein) to facilitate efficient cobalamin assembly . Understanding these interactions requires sophisticated protein-protein interaction analysis techniques.

In vivo approaches to mapping the cobS interactome include bacterial two-hybrid systems adapted for membrane proteins, which can identify direct interactions while maintaining the proteins in a membrane environment. Alternatively, proximity-based labeling techniques such as BioID, where cobS is fused to a promiscuous biotin ligase that biotinylates nearby proteins, can identify both stable and transient interaction partners in their native cellular context.

For detailed biochemical characterization of specific interactions, several complementary approaches prove effective:

  • Co-purification assays using tandem affinity purification with cobS as bait

  • Surface plasmon resonance (SPR) with cobS reconstituted into nanodiscs

  • Microscale thermophoresis (MST) to measure binding affinities in solution

  • Crosslinking mass spectrometry (XL-MS) to identify specific interacting residues

Integration of these approaches has revealed that cobS forms a functional complex with cobT, where the C-terminal domain of cobS interacts with the N-terminal domain of cobT through hydrophobic interactions . This interaction positions the active sites of both enzymes in proximity to facilitate efficient substrate channeling during cobalamin biosynthesis.

Additionally, studies employing quantitative proteomics techniques such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) have demonstrated that cobS expression levels are co-regulated with other cobalamin biosynthesis proteins, supporting the existence of a multi-enzyme complex or metabolon that enhances pathway efficiency .

What purification strategies yield the highest activity and structural integrity for recombinant cobS?

Purification of recombinant Shigella dysenteriae serotype 1 cobS with preserved structural integrity and enzymatic activity requires specialized approaches due to its membrane-associated nature. A sequential multi-step purification strategy typically yields the best results, beginning with careful membrane fraction isolation followed by selective extraction and multiple chromatography steps.

Optimal membrane extraction requires screening multiple detergents, with n-dodecyl-β-D-maltoside (DDM) at 1% (w/v) showing superior results for maintaining cobS activity . The critical extraction parameters include:

  • Detergent concentration (typically 1-1.5× the critical micelle concentration)

  • Extraction buffer ionic strength (typically 150-300 mM NaCl)

  • pH optimization (typically pH 7.5-8.0)

  • Inclusion of stabilizers (glycerol at 10-15% and specific lipids)

Following extraction, a refined chromatography sequence yields the highest purity while preserving activity:

Purification StepConditionsPurposeRecovery (%)
Immobilized metal affinity chromatography (IMAC)Ni-NTA resin, 20-250 mM imidazole gradientInitial capture70-80
Size exclusion chromatographySuperdex 200, 20 mM Tris pH 8.0, 150 mM NaCl, 0.05% DDMSeparation of monomeric from aggregated protein60-70
Ion exchange chromatographyQ-Sepharose, 0-500 mM NaCl gradientRemoval of contaminants with similar size50-60
Affinity chromatography (optional)Cobalt-based resinIsolation of functionally active enzyme40-50

Throughout purification, it is essential to monitor both protein purity and enzymatic activity. Activity assays should measure the specific cobS-catalyzed reaction using either radioactive substrates or coupled spectrophotometric assays that follow the conversion of the upper axial ligand precursor to the completed cobalamin structure . Final cobS preparations should be maintained in a stabilizing buffer containing reduced detergent concentration (0.03-0.05% DDM), phospholipids (0.01-0.02 mg/ml), and cryoprotectants like glycerol (10-15%) to maintain long-term stability.

How can researchers effectively compare expression levels and activity of wild-type versus mutant cobS variants?

When designing expression constructs for comparative studies, researchers should:

  • Maintain identical vector backbones, promoters, and regulatory elements

  • Use internal normalization controls (co-expressed reference protein)

  • Conduct expression in parallel under identical conditions

  • Perform time-course analyses to account for potential differences in expression kinetics

For enzymatic activity assessment, several complementary approaches provide robust comparative data:

Activity AssayMeasurement PrincipleAdvantagesLimitations
Radioisotope assayIncorporation of 57Co into complete cobalaminDirect measure of catalytic functionRequires radioisotope handling facilities
HPLC-based assayQuantification of cobalamin product formationPrecise quantification of productLower throughput
Coupled spectrophotometric assayIndirect measurement via reporter reactionsReal-time kinetic measurementsPotential interference from coupled enzymes
Thermal shift assayDifferential protein stability upon substrate bindingRapid screening of multiple variantsIndirect measure of activity

To ensure valid comparisons, enzymatic assays should be normalized to absolute protein concentration determined by methods such as amino acid analysis rather than total protein content. Additionally, kinetic parameters (kcat, KM) should be determined for each variant under identical conditions to distinguish effects on substrate binding versus catalytic efficiency .

Sophisticated data analysis approaches include global fitting of multiple datasets and calculation of specificity constants (kcat/KM) to provide comprehensive comparisons of catalytic efficiency across variants. Molecular dynamics simulations can complement experimental data by predicting how specific mutations might affect protein dynamics and substrate interactions .

What are the most reliable methods for confirming the correct membrane topology of expressed recombinant cobS?

Confirming the correct membrane topology of heterologously expressed Shigella dysenteriae cobS is essential for ensuring functional protein production. Multiple complementary approaches should be employed to verify proper membrane insertion and orientation.

Selective permeabilization coupled with protease accessibility provides direct evidence of membrane topology. This technique involves:

  • Selective permeabilization of either the inner or outer membrane using digitonin (outer membrane) or Triton X-100 (both membranes)

  • Treatment with proteases such as trypsin or proteinase K

  • Analysis of protected fragments using western blotting with domain-specific antibodies

This approach can determine which domains are exposed on each side of the membrane .

Cysteine scanning mutagenesis with thiol-specific labeling offers precise topological mapping. Researchers should:

  • Generate a cysteine-free version of cobS as a background construct

  • Introduce single cysteines at positions throughout the protein

  • Treat intact cells or membrane fractions with membrane-permeable and membrane-impermeable thiol-reactive reagents

  • Analyze labeling patterns to determine which residues are accessible from which side of the membrane

For even greater precision, fluorescence resonance energy transfer (FRET) can map distances between specific domains and the membrane surface. This requires:

  • Site-specific labeling of cobS with fluorescent donor probes

  • Incorporation of acceptor probes within the membrane

  • Measurement of energy transfer efficiency as a function of distance

These experimental approaches should be complemented by computational predictions using topology prediction algorithms such as TMHMM or Phobius, which analyze the amino acid sequence to predict transmembrane domains based on hydrophobicity profiles and charge distribution . The integration of these methods provides robust confirmation of proper membrane topology, which is essential for functional studies of cobS.

How should researchers interpret discrepancies between predicted and observed activities of recombinant cobS?

When researchers encounter discrepancies between predicted and observed activities of recombinant Shigella dysenteriae cobS, systematic troubleshooting and interpretation frameworks must be applied. First, consider that protein modeling predictions are based on homology to related proteins and may not capture all unique features of cobS. Activity discrepancies typically fall into several categories that require specific investigation approaches.

Structural integrity issues often manifest as lower-than-predicted activity. To address this, perform circular dichroism (CD) spectroscopy to assess secondary structure elements and compare with theoretical predictions . Additionally, limited proteolysis followed by mass spectrometry can identify misfolded regions through increased protease accessibility. Thermal shift assays with differential scanning fluorimetry can reveal stability differences between predicted models and actual protein.

Post-translational modifications represent another potential source of discrepancy. While bacterial proteins generally undergo fewer modifications than eukaryotic proteins, Shigella dysenteriae cobS may still experience modifications that affect activity. Mass spectrometry analysis should be employed to identify any unexpected modifications, particularly focusing on catalytic residues and substrate-binding sites .

Substrate accessibility issues frequently explain activity differences, particularly for membrane-associated enzymes like cobS. Assess detergent effects by testing multiple detergent types and concentrations to identify optimal micelle formation that maintains the native-like environment. Consider reconstitution into nanodiscs or liposomes to better mimic the native membrane environment when measuring activity .

Finally, develop a comprehensive activity model that accounts for:

  • Substrate concentration effects across a broad range (0.1-10× KM)

  • Cofactor requirements and potential limiting factors

  • Product inhibition effects

  • Time-dependent activity changes (stability assessment)

By systematically investigating these factors and integrating multiple analytical approaches, researchers can resolve discrepancies between predicted and observed activities, leading to refined models of cobS function and more accurate structure-function relationships .

What statistical approaches best analyze variability in cobS expression and activity across experimental replicates?

Rigorous statistical analysis of variability in Shigella dysenteriae cobS expression and activity requires application of appropriate statistical methods tailored to the specific experimental design. For basic expression analysis, coefficient of variation (CV) calculations across replicates provide a standardized measure of variability, with typical acceptable CV values below 15% for quantitative western blots and below 10% for mass spectrometry-based quantification .

For enzymatic activity data, more sophisticated approaches are necessary:

Statistical MethodApplication to cobS DataAdvantages
Nested ANOVAAnalysis of variance components from different sources (biological replicates, technical replicates, etc.)Partitions variability to identify major sources of experimental variation
Mixed-effects modelsAccount for both fixed effects (e.g., experimental conditions) and random effects (e.g., batch-to-batch variation)Provides more accurate estimates when dealing with hierarchical data structures
Bootstrapping methodsNon-parametric resampling to estimate confidence intervals for enzyme kinetic parametersRobust to deviations from normality and small sample sizes
Bayesian inferenceIntegration of prior knowledge with experimental data for parameter estimationHandles complex models and provides full probability distributions for parameters

When analyzing concentration-response relationships for cobS activity, researchers should employ global fitting of entire datasets rather than transformations like Lineweaver-Burk plots, which can disproportionately weight certain data points. Non-linear regression using enzyme kinetic models should include proper weighting schemes based on error structure in the data .

For comparing multiple cobS variants, researchers should conduct power analyses to determine the appropriate number of replicates needed to detect meaningful differences. As a general guideline, achieving 80% power to detect a 25% difference in activity typically requires a minimum of 4-6 independent biological replicates with 2-3 technical replicates each .

Finally, visualization approaches such as forest plots for comparing effect sizes across variants or conditions, and violin plots to display full data distributions, provide more informative representations than simple bar graphs with error bars .

How can structural data be integrated with functional assays to understand the catalytic mechanism of cobS?

Integration of structural data with functional assays enables comprehensive understanding of Shigella dysenteriae cobS catalytic mechanisms through a multi-layered analytical approach. This integration requires alignment of structural features with specific catalytic steps and rate-limiting processes in the enzymatic reaction.

Structure-guided mutagenesis provides a powerful framework for this integration. Begin by identifying conserved residues in the cobS sequence, particularly those in predicted catalytic sites or substrate-binding regions . Generate single point mutants targeting specific residues, then perform comprehensive kinetic characterization, including:

  • Determination of kcat and KM for each substrate

  • Analysis of pH-dependence profiles to identify critical ionizable groups

  • Solvent isotope effects to probe proton transfer steps

  • Temperature-dependence studies to calculate activation parameters

These functional data can be mapped onto structural models to create mechanism-based structural hypotheses .

Advanced spectroscopic techniques further bridge structural and functional analyses:

TechniqueStructural InformationFunctional Insight
Electron paramagnetic resonance (EPR)Electronic environment of cobalt centerOxidation state changes during catalysis
Resonance Raman spectroscopyVibrational modes of corrin ring structureSubstrate-induced conformational changes
X-ray absorption spectroscopy (XAS)Metal coordination geometryBond formation/breaking events
NMR chemical shift perturbationResidue-specific structural changesSubstrate and cofactor binding sites

Computational approaches like quantum mechanics/molecular mechanics (QM/MM) simulations can model transition states and reaction intermediates based on structural data, generating testable predictions about catalytic mechanisms . These predictions can then be validated using transition state analogs or mechanism-based inhibitors.

Time-resolved structural studies using techniques such as time-resolved crystallography or cryo-EM can capture conformational changes during the catalytic cycle, providing dynamic structural information that complements steady-state kinetic measurements . This integrated approach leads to a mechanistic model that connects atomic-level structural features with specific steps in the catalytic cycle of cobS.

What are the most promising approaches for enhancing stability and activity of recombinant cobS for structural studies?

Enhancing stability and activity of recombinant Shigella dysenteriae cobS for structural studies requires innovative approaches that address the inherent challenges of membrane protein stabilization. Directed evolution strategies offer significant promise, particularly when coupled with high-throughput screening assays that select for enhanced thermal stability while maintaining catalytic function . Researchers should establish a randomized mutagenesis library using error-prone PCR or DNA shuffling, followed by selection based on resistance to thermal denaturation or detergent-induced unfolding.

Computational protein engineering approaches provide complementary strategies. Rosetta-based computational design can identify stabilizing mutations by simulating the energetic effects of amino acid substitutions on protein folding and stability . Key targets for stabilization include:

  • Introducing disulfide bonds at positions that don't interfere with activity

  • Enhancing core packing through hydrophobic substitutions

  • Optimizing surface charge distribution to reduce aggregation propensity

  • Rigidifying flexible loops that might contribute to conformational heterogeneity

Innovative fusion partner approaches have shown particular promise for enhancing membrane protein stability. Beyond traditional solubility tags, consider:

Fusion PartnerMechanismAdvantage for cobS
Thermostabilized apo-cytochrome b562 (BRIL)Provides rigid scaffoldEnhanced crystallization propensity
T4 lysozymeIncreases soluble domain sizeProvides additional crystal contacts
Designed ankyrin repeat proteins (DARPins)Reduces conformational heterogeneityStabilizes specific conformational states
NanobodiesRecognizes and stabilizes native conformationsMinimal interference with function

Lipid nanodisc technology represents another promising approach for cobS stabilization. By incorporating the purified protein into nanodiscs comprised of synthetic phospholipids and membrane scaffold proteins, researchers can maintain cobS in a native-like membrane environment that enhances both stability and activity . Optimization of nanodisc composition through systematic lipid screening can identify specific lipid requirements for maximal cobS stability and function.

How might cobS be engineered to facilitate development of novel antimicrobial agents targeting Shigella dysenteriae?

Engineering Shigella dysenteriae cobS as a target for novel antimicrobial development presents a promising strategy due to its essential role in cobalamin biosynthesis. A structure-based drug design approach utilizing high-resolution structural data can identify unique binding pockets within cobS that are absent in human proteins, minimizing potential off-target effects .

The first step involves comprehensive structural characterization of cobS through crystallography or cryo-electron microscopy, with particular focus on identifying allosteric sites that might not be evident in homology models. Once identified, these sites can be validated through site-directed mutagenesis and functional assays to confirm their impact on enzyme activity .

Fragment-based drug discovery offers a powerful approach for cobS-targeted antimicrobial development:

  • Establish a fragment library of 1000-3000 small molecules (MW <300 Da)

  • Screen fragments using thermal shift assays, NMR, or surface plasmon resonance

  • Identify binding fragments through crystallographic or NMR-based methods

  • Elaborate fragments into lead compounds through medicinal chemistry

  • Optimize leads for membrane permeability and target specificity

Development of mechanism-based inactivators represents another promising strategy. By designing compounds that mimic the transition state of the cobS-catalyzed reaction, researchers can create highly specific inhibitors that form covalent bonds with catalytic residues . This approach requires detailed understanding of the reaction mechanism, which can be obtained through kinetic isotope effect studies and computational modeling of transition states.

To facilitate high-throughput screening, engineered reporter strains can be developed:

Screening SystemDesign ApproachAdvantages
Transcriptional fusionCouple cobS expression to reporter gene (GFP, luciferase)Monitors effects on gene expression
Protein complementationSplit-reporter system linked to cobS activityDirect measure of protein function
Growth-based selectionConditional cobS mutant with growth dependent on enzyme functionPhysiologically relevant readout
Metabolite biosensorReporter responsive to cobalamin levelsMonitors pathway output

These engineered systems enable rapid screening of compound libraries for molecules that specifically disrupt cobS function, providing starting points for antimicrobial development targeting this essential pathway in Shigella dysenteriae .

What potential exists for using recombinant cobS in development of novel Shigella dysenteriae vaccines?

Recombinant Shigella dysenteriae serotype 1 Cobalamin synthase (cobS) offers significant potential for novel vaccine development through several innovative approaches. As an essential metabolic enzyme with highly conserved epitopes across Shigella strains, cobS presents advantages as a vaccine antigen candidate, particularly when incorporated into rational vaccine design strategies .

Outer membrane vesicle (OMV)-based vaccines represent one of the most promising approaches. Similar to the strategy described for Shigella flexneri, engineered OMVs containing recombinant cobS can be developed through:

  • Integration of the cobS gene with appropriate regulatory elements into plasmids

  • Transformation into attenuated Shigella strains

  • Induction of OMV production and purification

  • Characterization of cobS presentation on OMV surfaces

This approach offers advantages including natural adjuvant properties of OMVs and presentation of cobS in its native conformation .

For DNA vaccine approaches, optimization strategies include:

  • Codon optimization of the cobS sequence for optimal expression in human cells

  • Selection of strong eukaryotic promoters (CMV, EF1α)

  • Inclusion of immunostimulatory sequences to enhance immune responses

  • Development of prime-boost strategies combining DNA and protein-based vaccines

Recombinant protein subunit vaccines using purified cobS can be enhanced through rational design modifications:

Modification ApproachImplementation StrategyImmunological Benefit
Epitope enhancementIdentification and modification of subdominant epitopesIncreased T-cell recognition
Multimeric displayCreation of cobS fusion proteins that form virus-like particlesEnhanced B-cell activation
Adjuvant conjugationChemical linkage to molecular adjuvants (TLR ligands)Directed immune polarization
GlycoengineeringAddition of specific glycan structuresImproved antigen presentation

Pre-clinical evaluation should include assessment of both humoral and cell-mediated immune responses in relevant animal models. Important immunological parameters to measure include:

  • Antigen-specific antibody titers and isotype profiles

  • Neutralizing antibody activity

  • T-cell responses (Th1/Th2/Th17 balance)

  • Memory B and T cell generation

  • Protection in challenge models

The development of recombinant cobS-based vaccines would benefit from comparative studies with other Shigella vaccine candidates, particularly those targeting O-antigens, to determine if combination approaches might provide superior protection through complementary immune mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.