Recombinant Shigella dysenteriae serotype 1 Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Important: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; SDY_1222; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
dsbB
Target Protein Sequence
MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWV PQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: sdy:SDY_1222

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the dsbB protein and what role does it play in Shigella dysenteriae serotype 1?

The disulfide bond formation protein B (dsbB) in Shigella dysenteriae serotype 1 is a membrane protein that plays a crucial role in the bacterial oxidative protein folding pathway. Similar to its homolog in Escherichia coli, dsbB functions as an oxidoreductase that reoxidizes the periplasmic enzyme DsbA, which is directly responsible for introducing disulfide bonds into newly translocated proteins in the periplasm. The dsbB protein is embedded in the inner membrane and contains four transmembrane domains with two cysteine pairs essential for its function. This protein transfers electrons from reduced DsbA to the respiratory chain components, allowing the DsbA-DsbB system to continuously catalyze disulfide bond formation in newly synthesized proteins that are critical for bacterial virulence and survival .

The significance of dsbB in S. dysenteriae becomes particularly evident when considering that this pathogen causes approximately 200,000 deaths annually and is the second most prevalent pathogen associated with bloody diarrhea, contributing to 12.9% of reported cases. The proper folding of virulence factors through disulfide bond formation is essential for bacterial pathogenesis .

How does the dsbB protein contribute to the virulence of Shigella dysenteriae?

The dsbB protein significantly contributes to S. dysenteriae virulence through its essential role in the correct folding of multiple virulence factors. By maintaining the DsbA protein in its oxidized, active state, the DsbA-DsbB system ensures the proper formation of disulfide bonds in secreted toxins and membrane proteins that are crucial for bacterial pathogenesis .

Most notably, dsbB indirectly facilitates the proper folding of Shiga toxin, which is listed as a category B biological warfare agent by the CDC due to its potent cytotoxicity. Shiga toxin consists of an enzymatically active A subunit and a pentamer of B subunits responsible for receptor binding. The B subunit contains disulfide bonds that require the DsbA-DsbB system for proper formation, ensuring the toxin's structural integrity and function .

Additionally, dsbB contributes to virulence by enabling the correct folding of:

  • Type III secretion system components

  • Membrane transporters including LptF and LolE, which are being studied as vaccine targets

  • Adhesins and invasins required for host cell invasion

Studies with recombinant Shiga toxin B subunit have shown that properly folded antigens can elicit protective immune responses, demonstrating both humoral and cellular immunity, characterized by increased antibody titers with predominance of IgG2a and IgG2b isotypes alongside elevated IgG1 levels .

What are the recommended protocols for cloning and expressing recombinant dsbB from Shigella dysenteriae serotype 1?

Genomic Extraction and Gene Amplification:

  • Extract genomic DNA from S. dysenteriae serotype 1 (strain SD197 is commonly used) using standard bacterial genomic isolation kits.

  • Design primers flanking the dsbB gene with appropriate restriction sites compatible with your expression vector.

  • Amplify the dsbB gene using high-fidelity PCR with optimized conditions (initial denaturation at 95°C for 5 minutes, followed by 30 cycles of 95°C for 30 seconds, 55-58°C for 30 seconds, 72°C for 1 minute, and final extension at 72°C for 10 minutes).

Expression System Selection:
Based on research with similar membrane proteins, the following expression systems are recommended:

Expression SystemAdvantagesChallengesBest For
E. coli K12 (pET-28a+)High expression levels, well-established protocols, cost-effectivePotential misfolding of membrane proteinsInitial protein characterization
E. coli C41(DE3)Specialized for toxic/membrane proteins, reduces toxicityLower yield than standard strainsFunctional studies of intact dsbB
Cell-free expressionAvoids toxicity issues, allows direct incorporation into liposomesHigher cost, technical complexityStructural studies, difficult-to-express variants

Optimization Strategies:

  • Use mild induction conditions (0.1-0.5 mM IPTG at 18-25°C)

  • Supplement with membrane-stabilizing agents (glycerol 5-10%)

  • Consider fusion tags that enhance membrane protein folding (e.g., Mistic, SUMO)

  • Implement codon optimization for E. coli expression systems, particularly for rare codons identified in S. dysenteriae

How can the functional activity of recombinant dsbB be assessed in vitro?

Several complementary approaches can be employed to assess the functional activity of recombinant dsbB protein:

1. Enzymatic Coupling Assay:

  • Reconstitute purified dsbB into proteoliposomes

  • Add purified, reduced DsbA and appropriate quinone cofactors

  • Monitor the rate of DsbA oxidation spectrophotometrically using DTNB (Ellman's reagent) to detect free thiols

  • Calculate reaction rates under varying substrate concentrations to determine kinetic parameters

2. Complementation of dsbB-null Mutants:

  • Transform dsbB-deficient E. coli strains with plasmids expressing S. dysenteriae dsbB

  • Assess restoration of disulfide-dependent phenotypes (e.g., motility, resistance to reducing agents)

  • Quantify the levels of properly folded disulfide-containing proteins in the complemented strain

3. Fluorescent Peptide Substrate Assay:

  • Design fluorescent peptides containing DsbA recognition motifs

  • Monitor changes in fluorescence as disulfide bonds form or break

  • Use this system to screen for inhibitors or modulators of dsbB activity

These methodologies provide qualitative and quantitative data on dsbB function, with the enzymatic coupling assay offering the most direct measure of catalytic activity. When performing these assays, it's critical to include appropriate controls, including heat-inactivated dsbB and known DsbB inhibitors, to validate the specificity of the observed activity .

What purification strategies yield highest purity and activity for recombinant dsbB?

Purifying membrane proteins like dsbB presents unique challenges requiring specialized approaches. The following purification strategy has been optimized for maintaining both purity and activity:

Membrane Preparation and Solubilization:

  • Harvest cells expressing dsbB and disrupt by sonication or French press

  • Isolate membrane fraction through differential centrifugation (typically 100,000×g for 1 hour)

  • Solubilize membranes using mild detergents - n-dodecyl-β-D-maltoside (DDM) at 1% or digitonin at 1-2% have shown superior results in preserving activity

Purification Protocol:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged dsbB (6-8M urea should be avoided as it denatures the protein)

  • Size exclusion chromatography to remove aggregates and detergent micelles

  • Optional ion exchange chromatography for further purification

Activity Preservation Measures:

  • Maintain detergent above critical micelle concentration throughout purification

  • Include glycerol (10-15%) and reducing agents (0.5-1mM TCEP) in all buffers

  • Avoid freeze-thaw cycles; store at 4°C for short-term or in small aliquots at -80°C with cryoprotectants

Yield and Purity Benchmarks:

Purification StepTypical Yield (mg/L culture)Purity (%)Activity Retention (%)
Membrane fraction5-1010-20100
IMAC2-570-8060-80
Size exclusion1-390-9550-70
Ion exchange0.5-2>9540-60

This protocol typically yields 1-2 mg of highly pure (>95%) and active dsbB protein per liter of bacterial culture. The final preparation should be assessed via SDS-PAGE, Western blotting, and activity assays to confirm both purity and functionality before experimental use.

What strategies can be employed to develop inhibitors targeting dsbB as potential antimicrobials against Shigella dysenteriae?

Developing inhibitors against dsbB represents a promising approach for novel antimicrobials, as this protein is essential for virulence factor maturation but absent in mammalian hosts. Several strategic approaches can be pursued:

Structure-Based Drug Design:
Using homology models based on E. coli dsbB or experimentally determined structures, computational screening can identify compounds that:

  • Compete with quinones for binding to dsbB

  • Disrupt the dsbB-DsbA interaction interface

  • Allosterically alter dsbB conformation to reduce catalytic efficiency

Virtual screening campaigns should prioritize compounds that interact with the conserved cysteine residues or quinone-binding pocket, as these represent the most functionally critical regions of the protein.

High-Throughput Screening Approaches:
Fluorescence-based assays measuring DsbA oxidation rates in the presence of dsbB can be adapted to screen chemical libraries. Compounds exhibiting >50% inhibition at 10 μM concentration would be considered primary hits, with subsequent dose-response studies to determine IC50 values.

Peptide-Based Inhibitors:
Peptides mimicking the DsbA interaction loop can compete for binding to dsbB. These peptides can be optimized through:

  • Incorporation of non-natural amino acids to enhance stability

  • Cyclization to restrict conformational flexibility

  • Addition of cell-penetrating sequences to improve membrane permeability

Quinone Analogs:
Since dsbB requires quinones as electron acceptors, structural analogs that competitively bind but fail to accept electrons represent another viable approach. These compounds would effectively trap dsbB in a catalytically incompetent state.

Inhibitor Development Pipeline:

StageCriteriaTimelineSuccess Rate
Primary screening>50% inhibition at 10 μM3-6 months0.1-0.5% of compounds
Hit confirmationReproducible dose-dependent inhibition1-2 months30-50% of primary hits
Structural optimizationImproved potency and ADME properties6-12 months10-20% of confirmed hits
In vitro efficacyMIC <10 μg/mL against S. dysenteriae2-3 months5-10% of optimized compounds
In vivo studiesEfficacy in infection models6-12 months1-5% of in vitro active compounds

This pipeline would ideally yield lead compounds with potential for further development into novel antimicrobials targeting multidrug-resistant Shigella dysenteriae strains, addressing a significant public health concern .

How can recombinant dsbB be utilized in vaccine development against Shigella dysenteriae?

Recombinant dsbB protein offers several promising avenues for vaccine development against Shigella dysenteriae, particularly as multidrug resistance becomes increasingly prevalent. Current approaches exploring dsbB's potential in vaccination strategies include:

Subunit Vaccine Approaches:
While dsbB itself has not been extensively studied as a direct vaccine antigen, the principles established with other membrane proteins from S. dysenteriae can be applied. Researchers have successfully identified promising membrane protein candidates such as LptF (Lipopolysaccharide export system permease protein) and LolE (Lipoprotein-releasing ABC transporter permease subunit) through computational analysis . Similar approaches could evaluate dsbB's immunogenic potential.

The process would involve:

  • Identification of surface-exposed loops in dsbB structure

  • Prediction of B-cell and T-cell epitopes within these regions

  • Construction of recombinant proteins containing multiple epitopes linked by appropriate spacers (KK, AAY, or GGGS linkers)

  • Addition of immunostimulatory adjuvants such as the RGD (arginine-glycine-aspartate) motif

Epitope-Based Vaccine Design:
Computational immunoinformatics can identify immunogenic epitopes from dsbB that could be incorporated into multi-epitope vaccines. This approach, successfully demonstrated with other S. dysenteriae membrane proteins, involves:

  • Predicting B-cell epitopes using IEDB with optimized parameters

  • Identifying MHC Class I and II epitopes with IC50 values <50

  • Screening epitopes for antigenicity, absence of allergenicity, and lack of toxicity

  • Combining selected epitopes using appropriate linkers

Attenuated Vector Vaccines:
Recombinant attenuated Salmonella or E. coli strains expressing dsbB epitopes represent another strategy. These live vectors can deliver dsbB-derived antigens to immune cells, potentially eliciting both mucosal and systemic immunity.

Immune Response Patterns:
Based on studies with other recombinant S. dysenteriae antigens, vaccines incorporating dsbB components would likely elicit:

  • Humoral immunity with production of neutralizing antibodies

  • Balanced Th1/Th2 responses with predominance of IgG2a and IgG2b isotypes along with elevated IgG1 levels

  • Cell-mediated immunity involving CD4+ and CD8+ T cells

Optimizing Expression for Vaccine Production:
For vaccine applications, codon optimization for expression in E. coli K12 using vectors like pET-28a(+) has proven effective for other S. dysenteriae membrane proteins. This approach yields sufficient quantities of properly folded recombinant proteins suitable for immunization studies .

Why might recombinant dsbB show inconsistent activity in experimental assays?

Inconsistent activity of recombinant dsbB in experimental assays can result from multiple factors that affect this membrane protein's stability and functionality. Researchers should systematically evaluate the following potential issues:

Expression and Purification Factors:

  • Detergent selection: Inappropriate detergents can distort the native conformation of dsbB. DDM and digitonin generally preserve activity better than more harsh detergents like SDS or Triton X-100.

  • Lipid environment: Absence of specific phospholipids required for optimal activity can reduce function. Supplementing purification buffers with E. coli lipid extracts (0.1-0.5 mg/mL) can often restore activity.

  • Metal contamination: Trace metals, particularly copper and iron, can promote oxidation of the catalytic cysteines. Including 1-5 mM EDTA in buffers can mitigate this effect.

Assay-Specific Variables:

  • Quinone availability: dsbB requires quinones as electron acceptors. Ensure ubiquinone (for aerobic conditions) or menaquinone (for anaerobic conditions) is present at 10-50 μM.

  • Redox buffer conditions: The starting redox state of assay components significantly impacts measured activity. Pre-reduction of DsbA with DTT (followed by removal of excess reductant) ensures consistent starting conditions.

  • Temperature fluctuations: dsbB activity shows a bell-shaped temperature dependence curve with optimal activity typically between 25-30°C. Temperature control within ±1°C is recommended.

Protein Quality Issues:

  • Proportion of active protein: Not all purified protein may be active; determine the percentage of active protein using active site titration with quinone analogs.

  • Aggregation state: dsbB tends to form inactive aggregates during storage. Dynamic light scattering can detect this issue before activity assays are performed.

Troubleshooting Decision Tree:

If experiencing inconsistent dsbB activity:

  • Verify protein integrity via SDS-PAGE (non-reducing and reducing conditions)

  • Assess aggregation state by size exclusion chromatography

  • Check redox state of catalytic cysteines using Ellman's reagent

  • Evaluate lipid and detergent composition by thin-layer chromatography

  • Supplement assay with fresh quinones and appropriate lipids

  • Consider protein reconstitution into nanodiscs or liposomes to provide a more native-like membrane environment

Implementing these systematic checks can significantly improve consistency across experimental replicates and between different protein preparations.

How can researchers address challenges in studying dsbB structure-function relationships?

Studying structure-function relationships of dsbB presents significant challenges due to its membrane-embedded nature and complex redox chemistry. Several advanced strategies can overcome these obstacles:

Structural Analysis Approaches:

  • Detergent screening: Systematic evaluation of different detergents for protein extraction should be conducted using thermal stability assays to identify conditions that maintain native folding.

  • Lipid nanodiscs: Reconstituting dsbB into nanodiscs provides a more native-like environment than detergent micelles, improving structural stability for subsequent analyses.

  • Cryo-EM: For detailed structural studies, single-particle cryo-electron microscopy can resolve membrane protein structures without crystallization, though protein size (~20 kDa for dsbB) presents challenges requiring strategies like fusion to larger scaffold proteins.

Functional Analysis Techniques:

  • Site-directed spin labeling: Introduction of spin labels at specific sites combined with electron paramagnetic resonance (EPR) spectroscopy can provide dynamic information about conformational changes during catalysis.

  • FRET-based assays: Engineering fluorescent protein pairs or small-molecule fluorophores at key positions allows monitoring of protein dynamics during substrate binding and catalysis.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can identify regions of conformational flexibility and solvent accessibility changes during the catalytic cycle.

Mutagenesis Strategies:
When studying structure-function relationships through mutagenesis, a thoughtful approach is necessary:

  • Conservative substitutions: Replace catalytic cysteines with serines to maintain similar size but eliminate redox activity

  • Domain swapping: Exchange domains between dsbB homologs from different species to identify species-specific functional elements

  • Scanning mutagenesis: Systematically substitute residues in putative functional regions with alanine to map the contribution of individual amino acids

Computational Methods:

  • Molecular dynamics simulations: Simulate dsbB behavior in membrane environments over nanosecond-to-microsecond timescales to identify dynamic properties not captured by static structures

  • Quantum mechanics/molecular mechanics (QM/MM): For studying the electron transfer mechanism, hybrid QM/MM approaches can model the quantum effects at the active site while treating the remainder of the protein classically

Integrated Workflow:
An effective integrated approach might follow this sequence:

  • Generate homology model based on E. coli dsbB structure

  • Validate model through targeted mutagenesis of predicted key residues

  • Refine structural understanding through spectroscopic methods

  • Apply MD simulations to explore conformational dynamics

  • Develop a comprehensive mechanism incorporating structural, spectroscopic, and kinetic data

This multilayered approach can overcome the inherent difficulties in studying membrane protein structure-function relationships, providing insights that no single technique could deliver in isolation .

What approaches can resolve contradictory data regarding dsbB function in different experimental systems?

Resolving contradictory data regarding dsbB function requires systematic investigation of experimental variables and careful consideration of biological differences. The following methodological approaches can help reconcile disparate findings:

Standardization of Experimental Systems:

  • Protein expression conditions: Establish standardized protocols for expression, using identical vectors, host strains, and induction parameters across laboratories.

  • Purification protocols: Develop consensus purification methods, specifying detergent types/concentrations and buffer compositions.

  • Activity assay parameters: Define standard assay conditions including temperature, pH, ionic strength, and substrate concentrations to enable direct comparison between studies.

Biological Source Considerations:

  • Strain variation: Sequence variations in dsbB from different S. dysenteriae isolates may contribute to functional differences. Complete sequencing of the dsbB gene from each strain is essential.

  • Growth conditions prior to analysis: The bacterial growth phase and media composition can alter membrane composition and protein expression levels, potentially affecting subsequent dsbB function measurements.

Comparative Analysis Framework:
When contradictory results persist despite standardization efforts, systematic comparison using multiple techniques in parallel can be revealing:

TechniqueStrengthsLimitationsResolution Approach
In vitro reconstitutionControlled environmentMay lack cellular cofactorsInclude cellular extracts to identify missing components
Genetic complementationPhysiological relevanceIndirect measure of functionCombine with biochemical assays of the same variants
Structural analysisDirect observation of protein stateStatic snapshotsComplement with dynamic methods (EPR, FRET)
Computational simulationMechanistic insightsRequires validationIdentify testable predictions for experimental verification

Statistical Approaches:

  • Meta-analysis: When sufficient data exists across studies, formal meta-analysis can identify patterns and sources of variability.

  • Bayesian analysis: This approach can incorporate prior knowledge and uncertainty, particularly valuable when data is limited or contradictory.

  • Power analysis: Ensure sufficient replication to detect biologically meaningful effects given the observed variability.

Collaboration and Standardization Initiatives:

  • Establish consortia for round-robin testing where identical protein preparations are analyzed in multiple laboratories

  • Develop reference standards (e.g., well-characterized dsbB preparations with certified activity levels)

  • Create open-access repositories for detailed protocols and raw data

By implementing these approaches, researchers can identify whether contradictions arise from methodological differences, biological variation, or represent genuine scientific insights into the complex function of dsbB in different contexts. This systematic framework transforms contradictory data from an obstacle into an opportunity for deeper mechanistic understanding .

How can recombinant dsbB be utilized to develop rapid diagnostic tests for Shigella dysenteriae?

Recombinant dsbB protein offers novel opportunities for developing diagnostic tools for Shigella dysenteriae detection, particularly in resource-limited settings where this pathogen causes significant morbidity and mortality. Several promising approaches leverage recombinant dsbB for diagnostic applications:

Antibody-Based Detection Systems:

  • ELISA Development: Using purified recombinant dsbB as an antigen, specific polyclonal or monoclonal antibodies can be generated for sandwich ELISA systems. While dsbB is not typically secreted, cell lysis during sample processing releases this protein, allowing detection.

  • Lateral Flow Immunoassays: For point-of-care applications, antibodies against unique epitopes of S. dysenteriae dsbB can be incorporated into paper-based lateral flow devices, enabling rapid diagnosis without sophisticated laboratory infrastructure.

Aptamer-Based Detection:

  • SELEX (Systematic Evolution of Ligands by Exponential Enrichment) can be employed to develop DNA or RNA aptamers with high affinity and specificity for S. dysenteriae dsbB.

  • These aptamers can be incorporated into electrochemical biosensors or fluorescence-based detection systems, offering advantages in stability and production cost over antibody-based methods.

PCR and Isothermal Amplification Approaches:

  • The dsbB gene contains regions unique to S. dysenteriae that can serve as targets for PCR-based detection.

  • LAMP (Loop-mediated isothermal amplification) assays targeting dsbB-specific sequences offer advantages for field deployment due to their isothermal nature and visual readout capabilities.

Performance Characteristics:
Based on similar diagnostic approaches for other bacterial pathogens, a well-optimized dsbB-based diagnostic system could achieve:

ParameterELISALateral FlowLAMP
Sensitivity85-95%70-85%90-98%
Specificity90-98%85-95%95-99%
Time to result3-4 hours15-30 minutes60-90 minutes
Sample requirement50-100 μL50-100 μL10-50 μL
Equipment needsMicroplate readerNoneSimple heat block
Cost per test$5-15$1-5$3-8

The development pathway should include:

  • Expression and purification of recombinant dsbB under native conditions

  • Validation of antigenic epitopes unique to S. dysenteriae

  • Development of detection reagents (antibodies or aptamers)

  • Prototype testing against reference strain panels

  • Field validation in endemic regions with diverse clinical presentations

These diagnostic approaches could significantly improve the speed and accuracy of S. dysenteriae detection, particularly valuable given the increasing antibiotic resistance in this pathogen and the importance of rapid, accurate diagnosis for appropriate treatment selection .

What are the applications of dsbB in structural biology research beyond Shigella dysenteriae?

The recombinant dsbB protein from Shigella dysenteriae represents a valuable model system for advancing structural biology research across several domains. Its applications extend well beyond the specific pathogen context:

Membrane Protein Methodology Development:
Dsbß serves as an excellent model system for developing and refining membrane protein structural biology techniques due to its:

  • Moderate size (~20 kDa), making it amenable to various structural methods

  • Multiple transmembrane domains representing typical membrane protein topology

  • Functional assayability, allowing correlation between structural features and activity

Methodological advances using dsbB as a model could include:

  • Optimization of membrane mimetics (nanodiscs, amphipols, SMALPs)

  • Development of crystallization strategies for membrane proteins

  • Refinement of single-particle cryo-EM approaches for smaller membrane proteins

Redox Biology Research Platform:
The DsbA-DsbB system represents one of the best-characterized redox relay systems, providing opportunities to study fundamental aspects of biological electron transfer:

  • Mechanism of disulfide relay systems

  • Coupling between electron transfer and conformational changes

  • Integration of membrane protein function with cellular energetics

Protein Engineering Applications:
Knowledge gained from dsbB structure-function studies can inform broader protein engineering efforts:

  • Design of synthetic redox pathways for biotechnology applications

  • Engineering of disulfide bond formation in heterologous expression systems

  • Development of switchable protein systems controlled by redox state

Comparative Structural Biology:
DsbB homologs exist across diverse bacterial species, offering opportunities for:

  • Comparative analysis to identify conserved structural features essential for function

  • Examination of species-specific adaptations that could inform pathogen-specific targeting

  • Investigation of convergent evolution in disulfide bond formation systems

Instrumentation Development:
The well-characterized nature of dsbB makes it valuable for:

  • Calibration of new structural biology instruments

  • Validation of computational modeling approaches for membrane proteins

  • Testing novel labeling strategies for spectroscopic techniques

Research Impact Metrics:
The broader impact of dsbB structural biology research can be assessed through:

Research ApplicationKnowledge Gap AddressedPotential Impact
Membrane protein methodologyEfficient structure determination of small membrane proteinsAccelerated drug development for membrane protein targets
Redox biology principlesMechanism of membrane-associated electron transferNew approaches to modulate cellular redox states
Protein engineeringDesign rules for disulfide engineeringEnhanced stability of therapeutic proteins
Evolutionary biologyAdaptation of redox systems across speciesInsights into bacterial adaptation to environmental niches

These diverse applications highlight how fundamental research on dsbB contributes to multiple fields beyond its immediate relevance to Shigella dysenteriae pathogenesis, exemplifying how basic science advances often have broad, interdisciplinary impacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.