Recombinant Shigella dysenteriae serotype 1 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; SDY_4395; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is employed during anaerobic growth, while succinate dehydrogenase functions during aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: sdy:SDY_4395

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate reductase subunit D (frdD) and what is its function in Shigella dysenteriae?

Fumarate reductase subunit D (frdD) is one of four essential components of the fumarate reductase enzyme complex in Shigella dysenteriae. Based on studies in related bacteria, frdD plays a critical role in membrane association of the fumarate reductase complex. The enzyme functions primarily during anaerobic respiration, catalyzing the reduction of fumarate to succinate as part of the bacterial respiratory chain when oxygen is unavailable. This process is crucial for energy generation in anaerobic environments, such as those encountered during infection of the human intestinal tract. In Shigella dysenteriae serotype 1, which is known to cause potentially life-threatening dysentery, this metabolic capability likely contributes to pathogen survival within the host environment .

What experimental systems are recommended for initial characterization of recombinant frdD?

For initial characterization of recombinant S. dysenteriae frdD, researchers should consider complementation studies similar to those employed with E. coli fumarate reductase. These approaches involve introducing recombinant plasmids carrying the frd operon into strains lacking chromosomal frd genes, followed by assessment of growth under anaerobic conditions with glycerol and fumarate as substrates. This methodology provides functional validation of the recombinant protein in a biological context. Additionally, biochemical assays such as the benzyl viologen oxidase assay can be employed to evaluate enzymatic activity. Importantly, initial characterization should include co-expression of frdD with other fumarate reductase subunits rather than in isolation, as proper functionality requires the complete complex. Expression systems using different host cell lines, modified bacterial growth conditions, and alternative plasmid expression vectors should be explored to optimize protein production and solubility .

What are the most effective strategies for cloning and expressing recombinant Shigella dysenteriae frdD?

Effective cloning and expression of recombinant S. dysenteriae frdD should incorporate several key strategies based on successful approaches with similar bacterial proteins. First, researchers should consider using E. coli as an expression host given its genetic similarity to Shigella and established protocols for heterologous protein expression. Selection of an appropriate expression vector is critical, with those containing inducible promoters offering better control over expression timing and levels. When designing constructs, researchers should pay particular attention to maintaining the native membrane-targeting sequences necessary for proper localization of frdD. For comprehensive studies of fumarate reductase function, co-expression of all four subunits (frdA, frdB, frdC, and frdD) is recommended, as separation of the genes encoding different subunits has been shown to affect the ability of fumarate reductase to assemble into a functional complex. Multiple expression approaches may need to be tested, including "the use of different host cell lines, modification of bacterial growth conditions, and the use of alternative plasmid expression vectors" to optimize protein production in a soluble, functional form .

How can researchers assess the functional integrity of purified recombinant frdD?

Assessing the functional integrity of purified recombinant frdD requires multiple complementary approaches. Since frdD primarily functions in membrane association rather than catalysis, traditional enzyme activity assays may not directly evaluate its specific role. Instead, researchers should assess proper complex formation with other fumarate reductase subunits using techniques such as size-exclusion chromatography, native PAGE, or co-immunoprecipitation. Membrane association can be evaluated through subcellular fractionation followed by Western blotting or through reconstitution experiments using liposomes or nanodiscs. Functional integrity of the complete fumarate reductase complex can be assessed using the benzyl viologen oxidase assay and by measuring the oxidation of reduced quinone analogs, which specifically requires proper function of both FRD C and FRD D subunits. Additionally, complementation studies in bacterial strains lacking the chromosomal frd operon can provide biological validation of functionality, as restoration of anaerobic growth on glycerol and fumarate would indicate proper functioning of the recombinant proteins .

How does the co-expression of frdD with other fumarate reductase subunits affect functionality?

Research with E. coli fumarate reductase provides critical insights into how co-expression affects functionality, with clear implications for S. dysenteriae frdD studies. Experimental evidence demonstrates that individual subunits of fumarate reductase cannot function properly when expressed in isolation. The FRD A and FRD B proteins only show activity in the benzyl viologen oxidase assay when expressed together as a dimer. Similarly, both FRD C and FRD D are required for proper membrane association of the complex and for the oxidation of reduced quinone analogs. Most importantly, the introduction of all four fumarate reductase subunits is essential for restoration of anaerobic growth on glycerol and fumarate. Even when all subunits are expressed but the genes for FRD C and FRD D are separated onto different plasmid vectors, functional activity is compromised. This indicates that the spatial and temporal coordination of subunit expression significantly impacts proper complex assembly. These findings underscore the importance of co-expression strategies when studying recombinant frdD, as isolated expression is unlikely to yield functionally relevant results .

What role might frdD play in the pathogenesis of Shigella dysenteriae infections?

The role of frdD in S. dysenteriae pathogenesis likely centers on its contribution to anaerobic metabolism, which is crucial for bacterial survival in the oxygen-limited environment of the human intestine. During infection, S. dysenteriae invades colonic epithelial cells, leading to localized cell death and inflammation characteristic of bacillary dysentery. In these microaerobic or anaerobic niches, fumarate reductase enables alternative respiratory pathways for energy generation when oxygen is unavailable. While not directly involved in virulence factor production, the metabolic capabilities provided by functional fumarate reductase may contribute to bacterial persistence and growth during infection. This is particularly relevant for S. dysenteriae serotype 1, which is known to cause potentially life-threatening disease. Understanding the role of frdD in pathogenesis also has implications for persistent infections, where metabolic adaptations may contribute to bacterial survival over extended periods. Recent research has demonstrated significant genomic plasticity in Shigella during persistent infection, suggesting that metabolic genes including those in the frd operon may undergo selection or modification during host adaptation .

How might structural analysis of frdD contribute to understanding its function?

Structural analysis of frdD would provide valuable insights into several aspects of its function in S. dysenteriae. Determining the three-dimensional structure through techniques such as X-ray crystallography, nuclear magnetic resonance spectroscopy, or cryo-electron microscopy would reveal the specific amino acid residues involved in membrane interaction, which is critical for proper localization of the fumarate reductase complex. Structural data would also identify interaction interfaces with other fumarate reductase subunits, particularly FRD C, with which it appears to work closely for membrane association. Additionally, structural information might reveal conformational changes that occur during complex assembly or enzyme function. Comparative structural analysis between S. dysenteriae frdD and homologs from other bacteria could highlight conserved regions essential for function versus species-specific adaptations. This knowledge would enhance our understanding of how frdD contributes to fumarate reductase activity and could potentially inform the development of inhibitors targeting this enzyme complex as a novel therapeutic approach against Shigella infections .

What conditions should be optimized for maximal expression of functional recombinant frdD?

Optimization of conditions for maximal expression of functional recombinant frdD requires attention to several key parameters. Growth temperature significantly impacts protein folding and solubility, with lower temperatures (16-25°C) often favoring proper folding of membrane-associated proteins. Induction parameters, including inducer concentration and induction time, should be systematically optimized to balance protein yield with proper folding. Since frdD is normally expressed under anaerobic conditions in vivo, creating microaerobic or anaerobic culture conditions may improve functional expression. Media composition also plays a crucial role, with supplementation of specific ions or cofactors potentially enhancing proper folding and stability. For membrane proteins like frdD, addition of glycerol or specific detergents to growth media may improve solubility. When expressing the complete fumarate reductase complex, coordinated expression of all four subunits is essential, which may require careful design of polycistronic constructs or co-transformation with multiple compatible plasmids. As noted in research with similar proteins, "a variety of approaches were used to prepare significant quantities of these proteins in their soluble forms, including the use of different host cell lines, modification of bacterial growth conditions, and the use of alternative plasmid expression vectors" .

What analytical techniques are most appropriate for studying frdD interactions with other fumarate reductase subunits?

Several analytical techniques are particularly well-suited for studying frdD interactions with other fumarate reductase subunits. Co-immunoprecipitation using antibodies against one subunit can pull down interacting partners, confirming physical association between frdD and other components of the complex. Surface plasmon resonance or isothermal titration calorimetry can quantify binding affinities and kinetics between purified subunits. For membrane proteins like frdD, techniques such as Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) allow detection of protein-protein interactions in membrane environments or even in living cells. Crosslinking experiments followed by mass spectrometry can identify specific residues involved in subunit interactions. Blue native polyacrylamide gel electrophoresis (BN-PAGE) is particularly valuable for analyzing intact membrane protein complexes while preserving native interactions. Functional complementation studies, as described for E. coli fumarate reductase, provide biological validation of proper complex formation by assessing restoration of growth under selective conditions. These approaches collectively provide a comprehensive view of how frdD interacts with other fumarate reductase subunits to form a functional complex .

How can researchers effectively study the membrane association properties of frdD?

Effective study of frdD membrane association properties requires specialized techniques appropriate for membrane proteins. Subcellular fractionation followed by Western blotting can determine the distribution of frdD between membrane and soluble fractions, confirming proper localization. Fluorescence microscopy using fluorescently tagged frdD can visualize membrane localization in live cells. For detailed biophysical characterization, reconstitution of purified frdD into artificial membrane systems such as liposomes, nanodiscs, or planar lipid bilayers allows controlled investigation of membrane interactions. Differential scanning calorimetry or fluorescence spectroscopy with environment-sensitive probes can detect changes in membrane properties upon frdD incorporation. Oriented circular dichroism spectroscopy can determine the orientation of frdD relative to the membrane plane. For identifying specific membrane-interacting regions, hydrogen-deuterium exchange mass spectrometry can map protected regions when the protein is membrane-associated. Site-directed mutagenesis of predicted membrane-interacting residues, followed by assessment of localization and function, can validate the importance of specific regions for membrane association. Research with E. coli fumarate reductase has established that both FRD C and FRD D are required for proper membrane association, suggesting they work cooperatively in this function .

What comparative genomic approaches can reveal insights about frdD conservation and variation?

Comparative genomic approaches offer powerful tools for understanding frdD conservation and variation across bacterial species. Sequence alignment of frdD genes from different Shigella strains and related enterobacteria can identify conserved regions likely essential for function versus variable regions that may reflect adaptation to specific niches. Phylogenetic analysis can reveal evolutionary relationships and potential horizontal gene transfer events affecting the frd operon. Analysis of selection pressure through calculation of nonsynonymous to synonymous substitution ratios (dN/dS) can identify regions under purifying or diversifying selection. Genomic context analysis examining gene neighborhood conservation can provide insights into regulatory relationships and operon structure across species. For S. dysenteriae specifically, comparison of frdD sequences across clinical isolates may reveal variations potentially associated with virulence or metabolic adaptation. As observed in recent research, "accessory genome dynamics and large structural genomic changes in Shigella during persistent infection" can significantly impact gene function and expression, potentially including the frd operon. Integration of these comparative approaches with structural predictions can highlight functionally significant variations that may impact protein-protein interactions or membrane association .

How should researchers interpret experimental data when frdD is expressed alone versus with other fumarate reductase subunits?

When interpreting experimental data, researchers must carefully consider the context of frdD expression. Evidence from E. coli studies indicates that "separation of the DNA coding for the FRD C and FRD D proteins affected the ability of fumarate reductase to assemble into a functional complex," suggesting that data from frdD expressed in isolation may not reflect its native behavior. In isolated expression experiments, researchers should expect potential differences in protein folding, stability, solubility, and localization compared to co-expression with other subunits. Functional assays performed with isolated frdD are likely to show minimal activity, as proper function requires assembly of the complete complex. When interpreting structural data from isolated frdD, researchers should consider that conformational changes may occur upon interaction with other subunits. For co-expression experiments, researchers should analyze data for evidence of complex formation and assess whether the observed properties align with those expected for the native enzyme. Complementation assays in strains lacking chromosomal frd genes provide the most biologically relevant context for interpretation, as restoration of growth under selective conditions demonstrates functional assembly of the complete complex .

What potential pitfalls should researchers be aware of when studying recombinant frdD?

Researchers studying recombinant frdD should be aware of several potential pitfalls that could impact experimental outcomes and data interpretation. First, as a membrane-associated protein, frdD may exhibit poor solubility when overexpressed, leading to inclusion body formation or aggregation that compromises functional studies. Expression tags, while useful for purification, may interfere with proper membrane association or interaction with other subunits, necessitating careful validation of tag placement and potential tag removal. Since proper function requires co-expression with other fumarate reductase subunits, expression of frdD alone may yield misleading results regarding its native properties. The membrane environment significantly impacts frdD structure and function, so studies in detergent micelles or artificial membranes may not perfectly recapitulate native conditions. Proper folding of membrane proteins often depends on specific chaperones or insertion machinery, which may be limiting in heterologous expression systems. Additionally, post-translational modifications present in the native context may be absent in recombinant systems. When designing complementation studies, researchers should ensure that the strain used lacks the complete chromosomal frd operon, as partial complementation with endogenous proteins could confound results .

How might antimicrobial resistance impact expression and function of fumarate reductase in Shigella dysenteriae?

The relationship between antimicrobial resistance (AMR) and fumarate reductase expression/function represents an important area for future investigation. Recent research has revealed significant acquisition of antimicrobial resistance genes during persistent Shigella infection, including "the gain of extended spectrum beta-lactamase genes in two pairs associated with persistent carriage." These changes in the bacterial genome and accessory elements could potentially impact metabolic pathways including anaerobic respiration. Several mechanisms might link AMR to fumarate reductase function: (1) Plasmids carrying AMR genes may impose metabolic burdens that alter expression of central metabolic enzymes including fumarate reductase; (2) Changes in membrane composition or potential associated with certain resistance mechanisms could affect membrane protein function, including frdD; (3) Regulatory networks responding to antibiotic stress might cross-talk with anaerobic regulatory systems controlling fumarate reductase expression; (4) Selection pressure from antibiotics could indirectly select for metabolic adaptations involving altered fumarate reductase activity. Understanding these potential interactions could reveal how AMR acquisition might influence bacterial fitness and persistence during infection, with particular relevance to S. dysenteriae serotype 1, which causes severe disease and is increasingly associated with antimicrobial resistance .

What role might structural variations in the frd operon play in Shigella adaptation during infection?

Structural variations in the frd operon likely play significant roles in Shigella adaptation during infection, representing an important direction for future research. Recent studies have revealed considerable genomic plasticity in Shigella during persistent infection, with evidence that "variations were mediated by insertion sequence (IS) elements which facilitated plasticity of genetic material with a distinct predicted functional profile." These findings suggest that the frd operon may undergo structural changes that influence expression, regulation, or even function of the fumarate reductase complex. Such variations could arise through several mechanisms: insertion or deletion events affecting regulatory regions, horizontal gene transfer introducing novel alleles, recombination between related sequences, or point mutations altering protein structure or interactions. These genomic changes may reflect adaptation to specific host environments encountered during infection, particularly the transition between aerobic and anaerobic conditions or adaptation to nutritional availability. Comparative analysis of frd operon structure across clinical isolates, particularly those from persistent infections, could reveal whether specific structural variations correlate with enhanced virulence, persistence, or metabolic flexibility. This research direction has particular relevance for understanding the evolution and adaptation of S. dysenteriae during host-pathogen interactions .

How could targeting fumarate reductase be exploited for novel therapeutic approaches against Shigella dysenteriae?

Targeting fumarate reductase represents a promising avenue for developing novel therapeutic approaches against Shigella dysenteriae, particularly for drug-resistant strains. Since fumarate reductase is essential for anaerobic growth, inhibitors of this enzyme could potentially limit bacterial survival in the anaerobic environment of the intestine during infection. Several aspects merit investigation in this therapeutic approach: (1) Development of small molecule inhibitors specifically targeting the unique structural features of S. dysenteriae fumarate reductase, potentially focusing on the membrane association mediated by frdD; (2) Evaluation of whether differences between bacterial and human succinate dehydrogenase (which catalyzes the reverse reaction) could be exploited for selective inhibition; (3) Investigation of combination therapies where fumarate reductase inhibitors might enhance the efficacy of existing antibiotics by limiting metabolic adaptation; (4) Assessment of resistance development potential and mechanisms for fumarate reductase-targeted therapeutics. This research direction is particularly relevant given the significant health impact of S. dysenteriae, which "causes an estimated 450,000 infections in the United States each year, and antimicrobial resistant infections result in an estimated $93 million in direct medical costs," highlighting the need for novel therapeutic approaches against this pathogen .

What collaborative approaches might accelerate research on recombinant Shigella dysenteriae frdD?

Accelerating research on recombinant S. dysenteriae frdD would benefit from multidisciplinary collaborative approaches that integrate diverse expertise and methodologies. Collaborative teams bringing together microbiologists, structural biologists, biochemists, and computational biologists could address the complex challenges of membrane protein expression, purification, and characterization. Integration of experimental approaches with computational methods such as molecular dynamics simulations could provide insights into frdD membrane interactions and complex assembly that would be difficult to obtain through experimental approaches alone. Collaborations between academic researchers and industrial partners with expertise in membrane protein crystallization or cryo-electron microscopy could overcome technical hurdles in structural determination. Public health partnerships could facilitate access to diverse clinical isolates for comparative studies of frdD sequence and expression. Additionally, collaborations with researchers studying host-pathogen interactions could place findings regarding fumarate reductase function into the broader context of Shigella pathogenesis. These collaborative approaches would build upon existing research showing that "now that these Ipa proteins are available in a highly pure form, it will be possible to initiate studies on their important biological and immunological properties," suggesting similar advances could be made with purified recombinant fumarate reductase components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.