Recombinant Shigella dysenteriae serotype 1 Lipid A export ATP-binding/permease protein MsbA (msbA) is a critical bacterial membrane transporter involved in lipid A moiety translocation, a process essential for lipopolysaccharide (LPS) assembly in Gram-negative bacteria . This engineered protein, produced via heterologous expression in E. coli, enables researchers to study bacterial membrane biology, antibiotic resistance mechanisms, and potential therapeutic targets .
The 582-residue sequence begins with MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD... and includes conserved motifs for ATP-binding (e.g., Walker A/B) and transmembrane permease activity .
MsbA facilitates the ATP-dependent transport of lipid A across the inner membrane, a rate-limiting step in LPS biosynthesis . Under host-induced stress (e.g., acidic pH), Shigella upregulates MsbA to maintain membrane integrity and virulence .
Drug Discovery: Used in high-throughput screens to identify inhibitors targeting lipid A biogenesis .
Structural Biology: Supports crystallographic studies to resolve ATP-binding domain conformations .
Pathogenicity Studies: Links MsbA activity to bacterial survival in hostile host environments .
| Feature | S. dysenteriae MsbA (Q32E34) | Rhodoferax ferrireducens MsbA (Q21WN9) |
|---|---|---|
| Length | 582 residues | 581 residues |
| Sequence Identity | 100% (species-specific) | ~45% |
| Key Motifs | Walker A/B, transmembrane helices | Similar ATPase domains |
The S. dysenteriae MsbA shares higher homology with enterobacterial homologs than environmental species, reflecting its adaptation to host-associated stress .
Solubility: Reconstitute in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .
Storage: Avoid repeated freeze-thaw cycles; aliquot for long-term use .
Genomic Conservation: The msbA gene is highly conserved across S. dysenteriae strains, including historical isolates like HNCMB 20080 (ST146) .
Stress Response: Proteomic studies show upregulated MsbA expression during host colonization, correlating with acid stress survival .
Defective Prophage Association: Unlike Shiga toxin-encoding prophages, MsbA’s genomic locus lacks phage integration sites, indicating stable functional conservation .
Research priorities include:
KEGG: sdy:SDY_2344
MsbA is a multidrug resistance transporter homolog that belongs to a superfamily of transporters containing an adenosine triphosphate (ATP) binding cassette (ABC), also called a nucleotide-binding domain (NBD). In Shigella dysenteriae and other Gram-negative bacteria, MsbA serves the essential function of transporting lipid A, a major component of the bacterial outer cell membrane, from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane .
This function is critical as MsbA is the only bacterial ABC transporter that is essential for cell viability. Without proper lipid A transport, the outer membrane cannot be properly assembled, leading to bacterial death . Additionally, MsbA has been shown to transport lipopolysaccharide (LPS), further contributing to outer membrane biogenesis .
MsbA consists of two main structural components:
Transmembrane domains (TMDs) that form the substrate-binding pocket and transport pathway
Nucleotide-binding domains (NBDs) that bind and hydrolyze ATP to drive conformational changes
The protein undergoes significant conformational changes during its transport cycle, alternating between:
Inward-facing conformation: Where the TMDs form a cavity open to the cytoplasm, allowing lipid A to enter the transporter
Outward-facing conformation: Where the TMDs are reoriented to open toward the periplasmic space, facilitating the release of lipid A
These conformational states have been captured through X-ray crystallography and cryo-EM studies. The inward-facing conformation displays a large amplitude opening in the transmembrane portal, which is necessary for the bulky lipid A molecule to enter the transport pathway . When ATP binds, it causes a packing rearrangement of the transmembrane helices and changes the accessibility from cytoplasmic (inward) facing to extracellular (outward) facing .
To study MsbA function in the laboratory setting, researchers employ several techniques:
ATPase activity assays: MsbA exhibits significant ATPase activity that can be measured to assess protein functionality. For example, purified MsbA from E. coli, V. cholerae, and S. typhimurium showed ATPase activities with Vmax values of 1.7, 5.3, and 2.0 μmol/min per milligram, respectively . The general protocol includes:
Purification of MsbA to homogeneity
Measuring ATP hydrolysis rates under various conditions
Determining kinetic parameters (Vmax, Km)
Assessing inhibition by compounds like AMPPNP (competitive inhibitor) and vanadate
Protein purification and reconstitution: MsbA can be expressed in E. coli, purified in detergents like dodecyl maltoside (DDM), and reconstituted in nanodiscs for functional studies .
X-ray crystallography and cryo-EM: These structural techniques have been crucial for understanding the conformational changes of MsbA during the transport cycle .
MsbA represents an attractive antimicrobial target for several reasons:
Essentiality: MsbA is essential for bacterial viability, making it a critical target for potential antibiotics .
Growing antimicrobial resistance: S. dysenteriae has acquired resistance to many conventional antibiotics, including ampicillin, trimethoprim, ciprofloxacin, and azithromycin . The CDC considers antibiotic-resistant Shigella a serious threat, with approximately 77,000 resistant infections reported annually in the United States .
Specificity to Gram-negative bacteria: Since MsbA is specific to Gram-negative bacteria and has structural differences from human ABC transporters, compounds targeting it might have fewer side effects .
Multidrug resistance role: MsbA is a polyspecific transporter capable of recognizing and transporting various drug molecules, potentially contributing to antibiotic resistance .
Transcriptomic analysis of S. dysenteriae isolated from different infection sites has revealed important insights into differential gene expression patterns, including those related to MsbA and other transport systems. A study comparing S. dysenteriae serotype 9 obtained from stool (non-invasive, Sd_FC3355) and blood (invasive, Sd_BA42767) specimens of the same patient showed significant differences in gene expression profiles .
Key findings include:
56 genes were differentially expressed between the invasive and non-invasive strains
The majority of genes (44/56) were highly expressed in the non-invasive isolate from the gut, which is the primary site of invasion for Shigella infection
Several genes, including cold shock protein (csp), DNA cytosine methyltransferase (dcm), histidine biosynthesis protein (hisE), and enterotoxin genes, were expressed only in the invasive strain, though with reduced expression
These expression differences highlight the adaptability of S. dysenteriae to different host environments
This differential expression profile suggests that MsbA and related transport systems may be regulated differently depending on the infection stage and site, potentially contributing to the pathogen's ability to adapt to different host environments .
Crystallization studies have provided valuable insights into the mechanism of lipid A transport by MsbA:
Substrate binding pathway: X-ray crystallography of MsbA from Salmonella typhimurium at 2.8 Å resolution after co-crystallization with lipid A revealed:
A large amplitude opening in the transmembrane portal that allows lipid A to enter the transport pathway
Putative lipid A density observed inside the transmembrane cavity, supporting a "trap and flip" model of transport
Additional electron density attributed to lipid A near an outer surface cleft at the periplasmic ends of the transmembrane helices, suggesting a potential exit pathway
Conformational changes: Comparison of different MsbA structures (nucleotide-free and nucleotide-bound) revealed:
A flexible hinge formed by extracellular loops 2 and 3 that allows the NBDs to disassociate while the ATP-binding half sites remain facing each other
Nucleotide binding causes a packing rearrangement of the transmembrane helices and changes the accessibility from inward-facing to outward-facing
The inward and outward openings are mediated by two different sets of transmembrane helix interactions
These structural insights suggest that large ranges of motion are required for substrate transport, with distinct conformational states facilitating the entry, binding, and release of lipid A .
Recent structural studies have revealed distinct mechanisms of action for first-generation MsbA inhibitors:
TBT1 inhibitor mechanism:
Unlike typical inhibitors, TBT1 triggers unproductive ATPase activity in MsbA
TBT1 binding induces an asymmetric, collapsed inward-facing conformation in MsbA
The central substrate-binding pocket becomes more constricted than in drug-free MsbA
Upon TBT1 binding, the NBD distance substantially decreases from ~47 to ~20 Å
The structural changes provide an explanation for the stimulation of ATPase activity: removal of the TM4-TM5.B bundle and sliding of TM6.A into the central cavity reduce inter-NBD distance, increasing the speed of NBD dimerization and ATP hydrolysis
G247 inhibitor:
The study of these inhibitors has already led to the identification of a new lead compound from virtual screening based on the TBT1-induced conformation, suggesting a promising avenue for the development of novel antibiotics targeting MsbA .
Based on successful studies with MsbA from related species, the following expression and purification strategies are recommended for S. dysenteriae MsbA:
Expression systems:
Purification protocol:
Functional reconstitution:
Activity verification:
The purified protein can then be used for structural studies (X-ray crystallography, cryo-EM) and functional assays. For example, A. baumannii MsbA expressed in E. coli cells, purified in DDM, and reconstituted in nanodiscs showed a basal ATPase activity of ~1 μmol ATP per minute per milligram .
MsbA contributes to antimicrobial resistance in S. dysenteriae through several mechanisms:
Direct drug efflux: As a member of the ATP-binding cassette (ABC) antibiotic efflux pump family, MsbA can directly export certain antibiotics from the bacterial cell, particularly nitroimidazole antibiotics . This efflux capacity makes it part of the intrinsic resistance mechanisms in S. dysenteriae.
Outer membrane integrity: By transporting lipid A and LPS to the outer membrane, MsbA helps maintain the permeability barrier that prevents many antibiotics from entering the cell . This barrier is particularly important for resistance against hydrophobic antibiotics.
Polyspecific substrate recognition: MsbA has been shown to be a polyspecific transporter capable of recognizing and transporting a wide spectrum of drug molecules, similar to other multidrug resistance transporters like MDR1 and LmrA .
Association with other resistance mechanisms: In S. dysenteriae clinical isolates, MsbA functions alongside other antimicrobial resistance genes including:
| Resistance Gene | Function |
|---|---|
| dhfr1A | Trimethoprim resistance |
| sulII | Sulfamethoxazole resistance |
| bla OXA | β-lactam resistance |
| bla CTX-M-1 | Extended-spectrum β-lactamase |
| qnrS | Quinolone resistance |
These resistance mechanisms have contributed to the emergence of multidrug-resistant Shigella strains, with pooled values of multidrug-resistant strains generally above 50% for both S. flexneri and S. sonnei .
When designing structural studies of MsbA-inhibitor complexes, researchers should consider:
Protein stabilization strategies:
Use of facial amphiphiles for co-crystallization to stabilize the protein in detergent micelles
Selection of appropriate detergents that maintain protein stability without interfering with inhibitor binding
Consideration of nanodiscs or other membrane mimetics for maintaining native-like environments
Crystallization approaches:
Co-crystallization with inhibitors rather than soaking, especially for compounds that may induce conformational changes
Screening of multiple constructs with various truncations or modifications to improve crystallization properties
Use of antibody fragments or nanobodies to stabilize specific conformations
Data collection and processing:
Functional validation:
These considerations are crucial for obtaining accurate structural information that can guide the development of new inhibitors targeting MsbA in S. dysenteriae and other pathogenic bacteria.
In vivo fluorescence techniques:
Fluorescently labeled lipid A analogs can be used to track transport in live bacteria
FRET-based assays can monitor conformational changes of MsbA in real-time
Single-molecule tracking can reveal the dynamics of individual MsbA transporters
Site-specific labeling and EPR spectroscopy:
Introduction of cysteine residues at strategic positions for spin labeling
Use of electron paramagnetic resonance (EPR) spectroscopy to monitor distance changes during the transport cycle
This approach can provide information about conformational dynamics under physiological conditions
Genetic approaches:
Construction of temperature-sensitive or inducible MsbA mutants
Monitoring changes in lipid A distribution and membrane composition upon MsbA inactivation
Correlation of these changes with bacterial viability and antimicrobial susceptibility
Mimicking the intracellular environment:
Development of in vitro systems that better recreate the native environment of MsbA
As noted in one study, "the in vivo mechanism of Shigellae invasion are difficult to fully study until the intracellular environment is mimicked in vitro"
This might include reconstitution in complex lipid mixtures that mimic the bacterial inner membrane
Transcriptomic and proteomic profiling:
By combining these approaches, researchers can gain a comprehensive understanding of MsbA function in the context of S. dysenteriae pathogenesis and identify potential vulnerabilities for therapeutic intervention.
When evaluating potential MsbA inhibitors against S. dysenteriae, several critical controls must be included to ensure valid and interpretable results:
Verification of target specificity:
Testing inhibitors against MsbA knockout strains complemented with plasmid-encoded MsbA to confirm on-target effects
Using site-directed mutagenesis of predicted binding residues to validate the binding mode
Comparing effects on related ABC transporters to assess selectivity
Functional assays:
ATPase activity measurements with proper controls:
Transport assays using labeled lipid A or model substrates
Membrane integrity assays to distinguish between direct inhibition and membrane disruption
Cytotoxicity and selectivity controls:
Testing on mammalian cells to assess selective toxicity
Hemolysis assays to detect membrane-damaging effects
Growth inhibition of bacteria lacking MsbA (Gram-positive) to identify off-target effects
Resistance development:
Serial passage experiments to monitor resistance development
Sequencing of resistant mutants to confirm whether resistance mutations map to msbA
Cross-resistance testing with known antibiotics
In vivo efficacy controls:
These controls are essential for developing MsbA inhibitors as potential therapeutic agents against S. dysenteriae infections, particularly given the increasing prevalence of multidrug-resistant strains.
The integration of MsbA inhibitors into combination therapies represents a promising approach to address multidrug-resistant S. dysenteriae infections:
Synergistic combinations with existing antibiotics:
MsbA inhibitors could potentiate the activity of antibiotics that are typically effluxed or blocked by the outer membrane
For example, combining MsbA inhibitors with β-lactams, fluoroquinolones, or macrolides might overcome existing resistance mechanisms
This strategy is particularly relevant given the high prevalence of resistance genes like bla OXA, bla CTX-M-1, and qnrS in clinical S. dysenteriae isolates
Targeting multiple steps in LPS biogenesis:
Combining MsbA inhibitors with compounds targeting other steps in LPS synthesis or transport
This multi-target approach could reduce the likelihood of resistance development
Potential complementary targets include LpxC (lipid A synthesis) and LptD (outer membrane insertion)
Sensitization to host immune defenses:
MsbA inhibition may alter the outer membrane composition, potentially increasing bacterial susceptibility to host antimicrobial peptides
Combination with immunomodulatory agents could enhance clearance of S. dysenteriae infections
Adjuvant therapy with bioconjugate vaccines:
MsbA inhibitors could be used alongside emerging Shigella bioconjugate vaccines
While vaccines like Flexyn2a have shown promise (51.7% vaccine efficacy against severe shigellosis), they don't provide complete protection
Combining vaccination with targeted antibiotic therapy could improve outcomes in high-risk populations
Delivery system considerations:
Development of nanoparticle formulations that co-deliver MsbA inhibitors with other antibiotics
Site-specific delivery systems to target the gastrointestinal tract, the primary site of S. dysenteriae infection
These integrated approaches could address the growing challenge of antibiotic resistance in S. dysenteriae, which has become a serious public health concern, particularly in low and middle-income countries where pooled values of multidrug-resistant strains generally exceed 50% .
Comparative analysis of MsbA across different pathogenic species provides valuable insights into both conserved and species-specific aspects of this essential transporter:
Structural conservation and variation:
MsbA orthologs from E. coli, V. cholerae, and S. typhimurium show high structural homology but exhibit differences in ATPase activity (Vmax values of 1.7, 5.3, and 2.0 μmol/min per milligram, respectively)
These differences may reflect adaptations to specific membrane compositions or environmental niches
Comparative structural analysis can identify conserved regions essential for function versus variable regions that might be targeted for species-specific inhibition
Species-specific inhibitor responses:
Evolutionary adaptations in pathogenic contexts:
Comparison of MsbA between pathogenic and non-pathogenic bacteria may reveal adaptations related to virulence
For S. dysenteriae, which causes severe dysentery, MsbA may have specific properties related to survival in the human gut and bloodstream
These adaptations could be targeted for therapeutic intervention
Resistome analysis:
MsbA is found in various resistomes, including perfect matches in Escherichia coli, Shigella boydii, S. dysenteriae, S. flexneri, and S. sonnei
Sequence variants are present in numerous other species including Citrobacter, Cronobacter, Enterobacter, Klebsiella, and Salmonella
This distribution information helps predict the potential spectrum of activity for MsbA-targeting therapeutics