Recombinant Shigella dysenteriae serotype 1 Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Role in Shigella dysenteriae

YidC is indispensable for membrane protein biogenesis in Shigella dysenteriae, a pathogen causing severe bacillary dysentery :

  • Pathogenesis: Facilitates insertion of virulence factors such as type III secretion system (T3SS) effectors (e.g., IpaC, OspF) .

  • Stress Adaptation: Enhances acid tolerance via amino acid decarboxylases (GadB, AdiA) and chaperones (HdeA/B) .

  • Energy Metabolism: Supports anaerobic respiration during host colonization .

In Vitro and In Vivo Studies

  • Insertase Activity: Recombinant YidC inserts Sec-independent substrates (e.g., M13 procoat) via its hydrophobic slide .

  • Synergy with Antimicrobials: E. coli YidC depletion sensitizes bacteria to essential oils (eugenol, carvacrol), suggesting therapeutic targeting potential .

  • Structural Dynamics: Molecular dynamics simulations reveal stable TM helices and flexible cytoplasmic loops critical for substrate interaction .

Key Mutations and Phenotypic Effects

MutationFunctional ImpactReference
YidC-5SDisrupted SecY interaction; impaired ATP synthase assembly
T362A/Y517ALoss of insertase activity

Applications in Research and Biotechnology

  • Vaccine Development: Used as an immunogen to generate antibodies targeting Shigella membrane proteins .

  • Drug Target Screening: RNA silencing of yidC combined with antimicrobials demonstrates synergistic bactericidal effects .

  • Structural Biology: Serves as a model for studying membrane protein insertion mechanisms .

Future Directions

  • Therapeutic Targeting: Explore YidC inhibitors to disrupt membrane protein biogenesis in antibiotic-resistant Shigella strains .

  • Structural Refinement: High-resolution cryo-EM studies to elucidate substrate-recognition mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yidC; SDY_4188; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWSPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. Involved in the integration of membrane proteins that utilize both Sec-dependent and Sec-independent pathways, as well as some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: sdy:SDY_4188

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of YidC in Shigella dysenteriae?

YidC in Shigella dysenteriae is a membrane protein insertase consisting of 548 amino acids that plays a critical role in membrane protein biogenesis. The protein contains multiple transmembrane segments organized to form a hydrophilic groove within the membrane, which is essential for its insertase activity. This structure enables YidC to interact with and facilitate the insertion of nascent membrane proteins into the cytoplasmic membrane. The N-terminal region includes a cytoplasmic α-helical hairpin that serves as an initial binding site for substrate proteins during the insertion process .

The primary function of YidC is to catalyze the insertion of membrane proteins into the lipid bilayer and supervise their proper folding. YidC functions through two main mechanisms: it can act independently as an insertase for Sec-independent substrates, and it can also work in conjunction with the Sec translocon to assist in the insertion and folding of more complex membrane proteins . The protein's dual role as both an insertase and a foldase is particularly significant, as it ensures that membrane proteins not only insert correctly but also achieve their proper tertiary structure necessary for function .

Recent research has demonstrated that YidC's foldase activity extends to the periplasmic domains of membrane proteins, highlighting its comprehensive role in protein biogenesis beyond simple membrane insertion. This multifunctional nature makes YidC essential for bacterial viability and positions it as a potential target for antibacterial development .

How does YidC conservation compare across bacterial species and other domains of life?

YidC represents a highly conserved protein family with homologues present in all domains of life, demonstrating its fundamental importance in cellular function across evolutionary boundaries. In bacteria, YidC homologues share significant sequence and structural conservation, particularly within the membrane-embedded core domains that form the hydrophilic groove essential for insertase activity. Comparing YidC across Shigella species (such as S. dysenteriae and S. boydii), high sequence identity is observed, reflecting their close evolutionary relationship and conserved function .

Beyond bacteria, YidC shares homology with Oxa1p in mitochondria and Alb3 in chloroplasts . This conservation extends to specific functional residues that are invariant across species. For example, glycine 355 (G355) in E. coli YidC is invariant in Staphylococcus aureus YidC, suggesting that this residue serves a conserved function in interactions with the Sec apparatus . Such conservation of specific residues across diverse bacterial species indicates their functional significance and provides potential targets for structure-function studies.

The evolutionary conservation of YidC extends to its mechanistic action as well. Across diverse species, YidC homologues facilitate membrane protein insertion through similar molecular mechanisms involving the binding of substrate proteins, their transfer to the membrane interface, and assistance in their proper folding and integration . This mechanistic conservation underscores the fundamental nature of YidC's role in cellular physiology and explains why YidC homologues are essential in virtually all living organisms studied to date.

What are the key domains and residues that define YidC functionality?

YidC functionality depends on several critical domains and specific amino acid residues that enable its insertase and foldase activities. The cytoplasmic α-helical hairpin domain plays a crucial role in the initial binding of substrate polypeptides. Single-molecule studies have revealed that this domain binds to substrates like the Pf3 coat protein within 2 milliseconds, showing high conformational variability and kinetic stability during this initial interaction . This domain serves as the first point of contact for nascent membrane proteins and helps guide them toward the membrane.

The hydrophilic groove formed by transmembrane segments constitutes another essential functional domain. This groove provides a protected environment that shields hydrophilic segments of substrate proteins from the hydrophobic membrane core during insertion. Within 52 milliseconds after initial binding, YidC uses this hydrophilic groove in conjunction with the cytoplasmic α-helical hairpin to transfer substrates to their final membrane-inserted, folded state .

Several specific residues have been identified as critical for YidC function. In E. coli YidC, glycine 355 (G355) and methionine 471 (M471) participate in interactions with the Sec apparatus, specifically with SecY . These residues likely facilitate the coordination between YidC and the Sec translocon during co-translational membrane protein insertion. The invariant nature of G355 across species like E. coli and S. aureus suggests its evolutionary importance in mediating these interactions .

Additional functional regions include transmembrane residues that mediate interactions with the Sec apparatus. Mutational studies have identified transmembrane residues critical for YidC's ability to interact with SecY and SecDF components of the Sec translocon . These interactions are essential for YidC's cooperative function with the Sec machinery, allowing for the integration of complex membrane proteins that require both systems for proper insertion and folding.

What are the optimal expression systems for producing recombinant Shigella dysenteriae YidC?

The production of functional recombinant Shigella dysenteriae YidC requires careful selection of expression systems that can accommodate the challenges associated with membrane protein expression. Based on current research methodologies, E. coli represents the most frequently utilized and optimized expression host for recombinant YidC proteins, including those from Shigella species . This bacterial expression system offers several advantages, including rapid growth, high protein yields, and genetic compatibility with Shigella, which belongs to the same family (Enterobacteriaceae).

For optimal expression in E. coli, several factors must be considered. The expression vector should contain a promoter that allows for controlled induction, such as the arabinose-inducible (Para) or IPTG-inducible (Plac) promoters, which prevent toxic effects from premature overexpression of membrane proteins. Adding affinity tags, particularly histidine (His) tags, facilitates subsequent purification while typically maintaining protein functionality . The recombinant YidC proteins from Shigella species are commonly expressed with N-terminal His tags, as this configuration generally does not interfere with the protein's membrane insertion and activity .

What purification strategies yield the highest purity and activity of recombinant YidC?

Purification of recombinant Shigella dysenteriae YidC requires specialized protocols that maintain both protein purity and functional activity. The most effective purification strategy involves a multi-step approach beginning with careful membrane isolation, followed by selective solubilization and chromatographic separation techniques.

The initial step involves bacterial cell lysis and membrane fraction isolation through differential centrifugation. Since YidC is a membrane protein, it remains in the membrane fraction and must be solubilized using detergents. The choice of detergent is critical; mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) effectively solubilize YidC while preserving its native conformation and activity . Harsher detergents like SDS should be avoided as they typically denature membrane proteins.

Affinity chromatography, particularly immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, serves as the primary purification step for His-tagged recombinant YidC. This step should be performed with detergent present in all buffers to maintain protein solubility. Washing with increasing imidazole concentrations (20-40 mM) removes non-specifically bound proteins, while elution with higher imidazole concentrations (250-300 mM) releases the His-tagged YidC .

For applications requiring exceptionally high purity, size exclusion chromatography (SEC) provides a valuable secondary purification step that separates YidC from remaining contaminants based on molecular size. SEC also helps identify and isolate properly folded, monodisperse YidC protein, which typically elutes as a single symmetrical peak. The purified protein is then typically stored in a buffer containing a stabilizing detergent and often supplemented with glycerol (6-50%) to prevent aggregation during storage . The recommended storage conditions include aliquoting the protein to avoid repeated freeze-thaw cycles, with storage at -20°C/-80°C for long-term preservation or at 4°C for up to one week for active working solutions .

How can researchers validate the proper folding and activity of purified recombinant YidC?

Validating the proper folding and functional activity of purified recombinant Shigella dysenteriae YidC requires multiple complementary approaches to ensure that the protein maintains its native structure and insertase/foldase capabilities. A comprehensive validation strategy should include both structural assessment and functional assays.

Structural validation begins with basic protein characterization using SDS-PAGE to confirm size and purity, ideally showing greater than 90% purity with a single dominant band at approximately 60 kDa (including the His-tag) . More sophisticated structural analysis includes circular dichroism (CD) spectroscopy to assess secondary structure content, confirming the expected high α-helical content characteristic of YidC. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can verify the monodispersity and proper oligomeric state of the purified protein, which is essential for activity .

For definitive functional validation, in vitro reconstitution assays provide the most direct evidence of YidC activity. Reconstituting purified YidC into proteoliposomes and measuring its ability to insert model substrates such as the Pf3 coat protein represents the gold standard for activity assessment . This assay specifically measures YidC's intrinsic insertase activity independent of other cellular components. A properly folded and active YidC should efficiently insert the Pf3 coat protein into proteoliposomes, which can be detected through protease protection assays or fluorescence-based methods .

Complementary approaches include binding assays using fluorescently labeled substrate peptides to measure substrate affinity and interaction kinetics. Single-molecule techniques such as force spectroscopy can provide detailed insights into the conformational changes and interaction dynamics between YidC and its substrates . These biophysical measurements can confirm that the purified YidC retains its native binding properties and can undergo the conformational changes necessary for substrate insertion.

How does YidC facilitate membrane protein insertion independently of the Sec translocon?

YidC's ability to function as an independent insertase represents a fascinating aspect of membrane protein biogenesis that operates parallel to the classical Sec pathway. The mechanism by which YidC facilitates Sec-independent membrane protein insertion involves several distinct steps that have been elucidated through reconstitution experiments and single-molecule studies.

The initial step involves substrate recognition and binding, which occurs rapidly (within approximately 2 milliseconds) through YidC's cytoplasmic α-helical hairpin domain . This domain exhibits high conformational variability, allowing it to adapt to different substrate proteins with diverse sequences. The binding event is characterized by high kinetic stability, providing a secure initial interaction between YidC and the substrate protein . This recognition step is specific but accommodates various Sec-independent substrates, such as the Pf3 coat protein, which has been extensively used as a model substrate in YidC studies .

Following initial binding, YidC facilitates the transfer of the substrate protein to the membrane interface within approximately 52 milliseconds. During this phase, YidC strengthens its binding to the substrate and utilizes both its cytoplasmic α-helical hairpin domain and hydrophilic groove to guide the substrate's transition . The hydrophilic groove provides a protected pathway through which hydrophilic segments of the substrate can traverse the hydrophobic membrane environment. This crucial feature explains how YidC can assist in translocating charged or polar regions of proteins across the membrane barrier without requiring the more complex Sec translocon machinery.

The final insertion step involves the lateral release of the substrate from YidC into the lipid bilayer. In this inserted state, substrates like the Pf3 coat protein exhibit low conformational variability, adopting stable transmembrane α-helical conformations typical of properly inserted membrane proteins . The membrane potential (ΔΨ) plays an important role in this process, particularly for substrates with charged residues that must be translocated across the membrane . In reconstituted systems, purified YidC alone is sufficient for the complete insertion of Sec-independent substrates into proteoliposomes, confirming its autonomous insertase activity .

What is the molecular mechanism of YidC's foldase activity for periplasmic domains of membrane proteins?

YidC's function extends beyond simple membrane insertion to include a sophisticated foldase activity that impacts not only transmembrane segments but also the periplasmic domains of membrane proteins. This dual functionality makes YidC a remarkably versatile player in membrane protein biogenesis. The molecular mechanism of YidC's foldase activity for periplasmic domains involves several interconnected processes that collectively ensure proper protein folding.

Recent studies have revealed that YidC's foldase activity extends to critical periplasmic enzymes such as penicillin-binding proteins (PBPs), which contain one transmembrane segment and a large periplasmic domain involved in peptidoglycan synthesis . In the absence of YidC, these PBPs are inserted into the membrane but fail to achieve proper folding of their periplasmic domains. This observation suggests that YidC not only assists in membrane insertion but also guides the initial folding events of domains that ultimately reside outside the membrane.

At the molecular level, YidC likely exerts its foldase activity by providing a protected environment at the membrane interface where newly translocated periplasmic domains can begin folding before complete release into the periplasmic space. The hydrophilic groove of YidC, which extends from the cytoplasmic side through the membrane, may continue to interact with emerging periplasmic segments, shielding them from inappropriate interactions and guiding their initial folding trajectory . This chaperoning function prevents misfolding and aggregation during the vulnerable early stages of protein folding.

YidC may also coordinate with periplasmic chaperones to achieve complete and correct folding of large periplasmic domains. As the nascent periplasmic domain emerges from YidC's protective environment, YidC could facilitate its transfer to dedicated periplasmic folding factors. This handoff mechanism would create a continuous folding pathway from the cytoplasm through the membrane and into the periplasm, ensuring that the protein maintains proper folding throughout its biogenesis journey .

How do specific mutations in YidC affect its interactions with the Sec apparatus?

The functional interplay between YidC and the Sec translocon represents a critical aspect of membrane protein biogenesis, and specific YidC mutations can significantly alter these interactions with both mechanistic and physiological consequences. Research has identified key residues in YidC that mediate these interactions, providing valuable insights into the molecular basis of YidC-Sec cooperation.

The highly conserved nature of certain interaction residues across species underscores their functional significance. For example, G355 is invariant between E. coli and Staphylococcus aureus YidC proteins, suggesting an evolutionarily conserved role in Sec interactions . This conservation likely reflects fundamental constraints on the YidC-Sec interface that have been maintained throughout bacterial evolution. Interestingly, while S. aureus YidC can complement YidC depletion in E. coli, it cannot complement SecDF depletion, indicating species-specific aspects of YidC-Sec interactions despite the conservation of key residues .

Mutations in YidC's transmembrane regions can alter the kinetics and efficiency of Sec-dependent protein insertion. These effects may result from disrupted physical interactions between YidC and Sec components, altered conformational dynamics of the YidC-Sec complex, or changes in the handoff of substrate proteins between the two systems . Understanding these mutation-induced alterations provides valuable guidance for structure-function analyses aiming to elucidate the precise molecular mechanisms of YidC-Sec cooperation in membrane protein biogenesis.

What in vitro assays can be used to study YidC-mediated membrane protein insertion?

In vitro assays for studying YidC-mediated membrane protein insertion provide controlled experimental systems that isolate specific aspects of YidC function while eliminating confounding cellular factors. These assays are essential for mechanistic investigations and fall into several complementary categories that collectively provide a comprehensive understanding of YidC activity.

Reconstitution assays represent the gold standard for studying YidC's insertase activity in vitro. These assays involve reconstituting purified YidC into artificial liposomes to form proteoliposomes, which serve as a minimal membrane system . The insertion activity is then assessed by adding purified substrate proteins, such as the Pf3 coat protein, to these proteoliposomes. Successful insertion can be monitored through protease protection assays, where properly inserted transmembrane segments are protected from protease digestion by the liposome membrane . This approach has definitively demonstrated that YidC alone is sufficient for the membrane integration of Sec-independent proteins, establishing its autonomous insertase activity.

For quantitative kinetic measurements, fluorescence-based assays provide valuable insights into the dynamics of YidC-mediated insertion. By incorporating environment-sensitive fluorophores into substrate proteins, researchers can monitor insertion in real-time as the fluorescence properties change when the labeled region transitions from an aqueous to a lipid environment . These assays allow determination of insertion rates under various conditions, revealing factors that influence YidC activity such as membrane composition, substrate properties, and the membrane potential.

Binding assays using techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) can characterize the initial interaction between YidC and its substrates. These methods measure binding affinities and kinetics, revealing how YidC recognizes diverse substrate proteins and how mutations affect these recognition events . When combined with site-specific labeling strategies, these approaches can map the substrate binding sites on YidC and track conformational changes that occur during the insertion process.

How can single-molecule techniques be applied to monitor YidC-substrate interactions?

Single-molecule techniques have revolutionized our understanding of YidC-mediated membrane protein insertion by revealing dynamic aspects of the process that remain hidden in ensemble measurements. These approaches offer unprecedented resolution of transient intermediates and conformational changes during YidC-substrate interactions, providing mechanistic insights at the molecular level.

Single-molecule force spectroscopy represents a powerful tool for studying YidC function. By applying controlled forces to individual substrate proteins interacting with YidC, researchers can probe the energetics and kinetics of different stages in the insertion process. This approach has revealed that within just 2 milliseconds, the cytoplasmic α-helical hairpin of YidC binds to substrate polypeptides (such as the Pf3 coat protein) with high conformational variability and kinetic stability . By measuring the force required to disrupt YidC-substrate interactions at different stages, researchers can construct detailed energy landscapes of the insertion pathway.

Complementary to force measurements, single-molecule fluorescence spectroscopy provides spatial and temporal information about YidC-substrate interactions. Techniques such as Förster resonance energy transfer (FRET) between fluorophores placed on YidC and its substrates allow researchers to track distance changes and conformational dynamics during the insertion process . These studies have shown that within 52 milliseconds after initial binding, YidC strengthens its interaction with the substrate and facilitates its transfer to the membrane-inserted state, where the substrate exhibits significantly reduced conformational variability characteristic of properly folded transmembrane proteins .

Advanced imaging techniques such as high-speed atomic force microscopy (HS-AFM) can visualize individual YidC molecules in membrane environments and track conformational changes in real-time. Combined with computational approaches like molecular dynamics simulations, these experimental techniques create a comprehensive picture of the insertion process at unprecedented resolution . The integration of multiple single-molecule approaches provides complementary information about different aspects of YidC function, from initial substrate recognition to final membrane integration and folding.

What genetic approaches are effective for studying YidC function in vivo?

Genetic approaches provide powerful tools for investigating YidC function within the complex cellular environment, allowing researchers to connect molecular mechanisms with physiological outcomes. Several complementary genetic strategies have proven particularly valuable for studying YidC in vivo, each offering unique advantages for addressing specific aspects of YidC biology.

Controlled depletion systems represent a cornerstone of YidC genetic studies. Since YidC is essential for bacterial viability, complete knockout mutations are lethal. To circumvent this challenge, researchers have developed strains where YidC expression is placed under the control of inducible promoters, such as the arabinose-inducible Para promoter . By shifting cells from inducing to non-inducing conditions, YidC can be gradually depleted, allowing researchers to observe the physiological consequences of YidC deficiency without immediate cell death. These systems have revealed that YidC depletion leads to growth retardation and ultimately cell death, confirming its essential role in bacterial physiology .

Site-directed mutagenesis provides insights into structure-function relationships by systematically altering specific residues in YidC. Particularly informative are mutations in transmembrane regions that affect interactions with the Sec apparatus . By creating libraries of YidC mutants and screening for those that fail to complement YidC depletion or show altered interactions with other components of the protein insertion machinery, researchers have identified critical functional residues. For example, mutations affecting glycine 355 (G355) and methionine 471 (M471) in E. coli YidC disrupt interactions with SecY, highlighting their importance in YidC-Sec cooperation .

Antisense RNA expression represents an innovative approach for specific downregulation of YidC in vivo. By expressing RNA molecules complementary to yidC mRNA, researchers can reduce YidC synthesis without completely eliminating it . This approach has several advantages, including tunable repression levels and compatibility with high-throughput screening methods. Studies using antisense-mediated YidC silencing have demonstrated that even partial reduction of YidC levels impairs bacterial growth and sensitizes cells to antibacterial agents such as essential oils (eugenol and carvacrol), supporting YidC's potential as an antibacterial target .

What evidence supports YidC as a potential antibacterial target?

Multiple lines of evidence converge to establish YidC as a promising antibacterial target with significant therapeutic potential. The compelling case for YidC as a drug target stems from its essential nature, conservation across bacterial pathogens, absence in mammalian cells, and demonstrated vulnerability to inhibition.

The essential role of YidC in bacterial viability provides the fundamental rationale for its consideration as an antibacterial target. Genetic studies have consistently demonstrated that YidC depletion leads to growth arrest and ultimately cell death across multiple bacterial species . This essentiality reflects YidC's critical function in membrane protein biogenesis, a process indispensable for bacterial survival. Unlike many antibacterial targets that bacteria can circumvent through alternative pathways, YidC's function cannot be readily compensated by other cellular machinery, reducing the likelihood of resistance development through pathway redundancy.

YidC's conservation across diverse bacterial pathogens, including Shigella species, enhances its appeal as a broad-spectrum target. The protein shows significant sequence and structural conservation, particularly in functional domains, suggesting that inhibitors targeting conserved features might show activity against multiple bacterial species . This conservation extends to critical residues involved in substrate binding and insertion, offering potential binding sites for small molecule inhibitors with broad-spectrum activity.

Sensitization experiments provide direct evidence of YidC's druggability. Research has shown that even partial reduction of YidC levels through antisense RNA expression significantly sensitizes bacteria to antibacterial compounds . Specifically, YidC-depleted Escherichia coli exhibits enhanced susceptibility to essential oils like eugenol and carvacrol, with Fractional Inhibitory Concentration Indices (FICIs) indicating high levels of synergy between YidC silencing and these compounds . This synergistic effect suggests that even partial inhibition of YidC function can substantially compromise bacterial viability when combined with other stressors, a promising prospect for combination therapy approaches.

What methodologies exist for screening potential YidC inhibitors?

Developing effective screening methodologies for YidC inhibitors requires specialized approaches that address the challenges associated with targeting membrane proteins. Several complementary screening strategies have been developed or adapted for identifying compounds that specifically inhibit YidC function.

Genetic sensitization screens represent a particularly powerful approach for YidC inhibitor discovery. By creating bacterial strains with reduced YidC levels through controllable promoters or antisense RNA expression, researchers can establish systems where cells become hypersensitive to YidC inhibitors . These strains can then be used in whole-cell screening assays, where compounds that preferentially inhibit growth of YidC-depleted cells compared to wild-type cells are identified as potential YidC-targeting agents. This approach has successfully identified essential oils (eugenol and carvacrol) that show synergistic activity with YidC depletion, demonstrating the feasibility of this screening strategy .

In vitro functional assays provide more direct evidence of YidC inhibition. Using reconstituted systems with purified YidC in proteoliposomes, researchers can screen for compounds that block the insertion of model substrates such as the Pf3 coat protein . Successful insertion can be monitored through protease protection assays or fluorescence-based methods, providing quantitative measurements of YidC activity in the presence of potential inhibitors. This approach allows for the identification of compounds that directly interfere with YidC's insertase function rather than affecting upstream processes.

Structure-based virtual screening has become increasingly feasible as structural information about YidC becomes available. Computational methods can be used to identify small molecules predicted to bind to critical functional sites on YidC, such as the substrate-binding groove or regions involved in interactions with the Sec apparatus . These in silico approaches can efficiently screen large virtual compound libraries, prioritizing candidates for subsequent experimental validation based on predicted binding affinity and specificity.

How can antisense RNA expression be used to validate YidC as a therapeutic target?

Antisense RNA expression represents a sophisticated genetic approach for validating YidC as a therapeutic target, offering unique advantages that complement other validation methods. This technique provides a tunable system for specific YidC downregulation that closely mimics the effects of partial pharmacological inhibition.

The methodology involves expressing RNA molecules complementary to yidC mRNA, which bind to the target transcript and interfere with its translation through various mechanisms including steric hindrance of ribosome binding, induction of RNase H-mediated degradation, or disruption of mRNA secondary structure . The degree of inhibition can be controlled by modulating antisense RNA expression levels, allowing researchers to achieve varying degrees of YidC depletion. This tunability is particularly valuable for identifying the threshold of YidC inhibition needed to impact bacterial viability, informing the target inhibition level for drug development.

Experimental implementation typically involves constructing expression vectors containing antisense sequences targeting specific regions of the yidC gene. Studies have successfully employed this approach in Escherichia coli, demonstrating that antisense-mediated yidC silencing results in significant growth retardation . The growth defect phenotype provides clear confirmation of YidC's essentiality and serves as a measurable endpoint for assessing the effectiveness of antisense constructs.

Beyond simply confirming essentiality, antisense RNA expression enables sophisticated drug interaction studies that directly address YidC's potential as a therapeutic target. Researchers have demonstrated that yidC silencing sensitizes E. coli to antibacterial essential oils eugenol and carvacrol, with Fractional Inhibitory Concentration Indices (FICIs) indicating high levels of synergy . This synergistic effect is particularly significant as it suggests that even partial inhibition of YidC function can substantially enhance the efficacy of other antibacterial agents, a valuable property for combination therapy approaches that could reduce the emergence of resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.