Recombinant Shigella dysenteriae serotype 1 NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; SDY_2484; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function

NDH-1 (NADH-quinone oxidoreductase) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediate electron carriers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus establishing a proton gradient to conserve redox energy.

Database Links

KEGG: sdy:SDY_2484

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in Shigella dysenteriae?

NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the respiratory chain in Shigella dysenteriae. It functions as part of the NADH dehydrogenase I complex, catalyzing electron transfer from NADH to ubiquinone coupled with ion translocation across the bacterial membrane. In Shigella, this enzyme is essential for energy metabolism and contributes to bacterial survival by participating in the generation of the sodium motive force (SMF) that drives various cellular processes including substrate uptake, ATP synthesis, and cation-proton antiport .

The nuoA protein is relatively small (147 amino acids) and forms one of the membrane-bound subunits of the larger NADH dehydrogenase complex. Its specific role involves anchoring the complex to the bacterial membrane and facilitating the coupling of electron transfer with ion translocation .

How does the recombinant nuoA protein from Shigella dysenteriae serotype 1 differ from native protein?

The recombinant Shigella dysenteriae serotype 1 NADH-quinone oxidoreductase subunit A (nuoA) protein differs from the native form primarily in the following ways:

  • Addition of affinity tags: The recombinant protein typically contains an N-terminal His-tag to facilitate purification through affinity chromatography .

  • Expression system: While the native protein is expressed in Shigella dysenteriae, the recombinant form is commonly expressed in heterologous systems, particularly Escherichia coli, which may affect post-translational modifications .

  • Formulation: The recombinant protein is typically provided as a lyophilized powder in a buffer containing stabilizers like trehalose, whereas the native protein exists integrated into the bacterial membrane .

  • Purity level: Recombinant preparations typically achieve greater than 90% purity as determined by SDS-PAGE, which is significantly higher than what would be obtained from native membrane preparations .

What are the optimal conditions for reconstitution and storage of recombinant Shigella dysenteriae nuoA protein?

For optimal reconstitution and storage of recombinant Shigella dysenteriae nuoA protein, researchers should follow these methodological guidelines:

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal: 50%) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Storage Conditions:

  • Store lyophilized powder at -20°C to -80°C upon receipt

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 as a storage buffer

How can researchers effectively express and purify recombinant Shigella dysenteriae nuoA protein for structural and functional studies?

Expression System Selection:
E. coli is the preferred expression system for recombinant Shigella dysenteriae nuoA protein due to genetic similarity between the organisms. BL21(DE3) or similar strains are typically employed as they lack certain proteases that might degrade the target protein .

Expression Vector Design:

  • Use expression vectors containing T7 or similar strong promoters

  • Include an N-terminal His-tag sequence for purification

  • Optimize codon usage if necessary for efficient expression

  • Consider inclusion of a cleavable tag if native protein is required for downstream applications

Purification Strategy:

  • Cell lysis: Sonication or pressure-based methods in the presence of mild detergents (e.g., 1% Triton X-100) to solubilize membrane proteins

  • Primary purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Secondary purification: Size exclusion chromatography to remove aggregates and obtain homogeneous protein

  • Quality control: Assess purity by SDS-PAGE (target >90% purity) and identity by Western blotting

Detergent Considerations:
Since nuoA is a membrane protein, detergent selection is critical. Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin for extraction while maintaining native-like folding and function.

What role does nuoA play in the pathogenesis of Shigella dysenteriae and how might it be exploited as a therapeutic target?

NADH-quinone oxidoreductase subunit A (nuoA) plays several key roles in Shigella pathogenesis that make it a potential therapeutic target:

Pathogenic Significance:

  • Energy metabolism: As part of the respiratory chain, nuoA contributes to bacterial energy generation critical for survival and virulence

  • Iron homeostasis: Studies of related Na+-translocating NADH:quinone oxidoreductase systems reveal significant influence on iron metabolism, which is essential for bacterial pathogenesis

  • Membrane potential maintenance: The enzyme contributes to the sodium motive force (SMF) that drives various cellular processes including flagellar rotation and substrate uptake

Therapeutic Target Potential:

  • Essential function: Disruption of respiratory chain components can severely compromise bacterial viability

  • Surface accessibility: As a membrane protein, nuoA might be accessible to antibiotics or inhibitors

  • Unique bacterial features: The NADH-quinone oxidoreductase complex differs significantly from mammalian counterparts, allowing for selective targeting

  • Role in iron metabolism: The relationship between NQR and iron metabolism provides an additional vulnerability that could be exploited

Research approaches for targeting nuoA might include:

  • High-throughput screening of small molecule inhibitors

  • Structure-based drug design using the predicted or resolved structure of nuoA

  • Antisense RNA or CRISPR-based approaches to downregulate nuoA expression

  • Immunological targeting through antibodies against extracellular domains

How can researchers investigate the interaction between nuoA and other subunits of the NADH-quinone oxidoreductase complex?

Investigating protein-protein interactions within the NADH-quinone oxidoreductase complex requires sophisticated approaches:

Co-immunoprecipitation (Co-IP):

  • Generate antibodies specific to nuoA or use anti-His antibodies if working with tagged recombinant proteins

  • Solubilize bacterial membranes using mild detergents that preserve protein-protein interactions

  • Precipitate nuoA using antibodies coupled to agarose or magnetic beads

  • Analyze co-precipitated proteins by mass spectrometry or Western blotting

Crosslinking Studies:

  • Use membrane-permeable crosslinkers like formaldehyde or DSP (dithiobis(succinimidyl propionate))

  • Apply optimal crosslinking conditions (concentration, time, temperature)

  • Isolate crosslinked complexes by immunoprecipitation or affinity purification

  • Identify crosslinked partners through mass spectrometry

Bacterial Two-Hybrid Systems:

  • Create fusion constructs of nuoA and potential interacting partners with complementary fragments of a reporter protein

  • Express in an appropriate bacterial strain

  • Measure reporter activity as an indicator of protein-protein interaction

Cryo-Electron Microscopy:
For structural determination of the entire complex, cryo-EM has emerged as a powerful technique that can resolve membrane protein complexes without the need for crystallization, providing insights into how nuoA interacts with other subunits within the native environment.

What are the challenges and solutions in developing antibodies against Shigella dysenteriae nuoA for immunological studies?

Challenges in Anti-nuoA Antibody Development:

ChallengeDescriptionPotential Solutions
Membrane protein naturenuoA's hydrophobic nature makes it difficult to use as an immunogenUse synthetic peptides from predicted extracellular regions or purify protein in detergent micelles
Limited exposed epitopesMembrane integration limits accessible epitopesFocus on N or C-terminal regions that may be more exposed
Cross-reactivityHigh conservation among bacterial NADH dehydrogenases may cause cross-reactivityIdentify unique antigenic regions specific to Shigella dysenteriae nuoA
Conformational epitopesImportant epitopes may be conformational rather than linearUse native-like recombinant protein preparations for immunization

Methodological Approach for Antibody Development:

  • Antigen Preparation:

    • Recombinant full-length protein with His-tag for purification

    • Synthetic peptides corresponding to hydrophilic regions

    • Fusion proteins with carrier proteins like KLH or BSA

  • Immunization Strategy:

    • Use multiple host species (rabbit, mouse, goat) for diverse antibody repertoires

    • Employ adjuvants appropriate for membrane proteins

    • Follow prime-boost immunization schedules for optimal response

  • Antibody Validation:

    • Western blotting against recombinant protein and native bacterial lysates

    • Immunofluorescence to confirm surface accessibility

    • Negative controls using knockout strains

    • Cross-adsorption to eliminate cross-reactivity

  • Application-Specific Considerations:

    • For immunoprecipitation: optimize detergent conditions

    • For flow cytometry: verify accessibility on intact bacteria

    • For immunohistochemistry: optimize fixation methods

How can researchers differentiate between Shigella dysenteriae nuoA and homologous proteins from other bacterial species?

Differentiating between Shigella dysenteriae nuoA and homologous proteins from other bacterial species is essential for specificity in research. Here's a methodological approach:

Sequence-Based Differentiation:

  • Perform multiple sequence alignment of nuoA proteins from different bacterial species

  • Identify unique sequence regions specific to Shigella dysenteriae

  • Design primers or probes targeting these regions for PCR or hybridization-based detection

  • Develop specific antibodies against unique epitopes

Comparative Analysis of Key Differences:

FeatureShigella dysenteriae nuoAE. coli nuoAOther Enterobacteriaceae
Protein length147 amino acids147 amino acidsVariable (140-150 aa)
Unique residuesSpecific amino acids at positions 34, 76, and 112 (example)Different residues at these positionsSpecies-specific variations
Post-translational modificationsSpecies-specific patternsDifferent patternVaried by species
Antibody reactivitySpecific epitope recognitionCross-reactivity possibleVariable cross-reactivity

Experimental Approaches:

  • Western Blotting: Use stringent washing conditions and highly specific antibodies

  • Mass Spectrometry: Identify species-specific peptide fragments after enzymatic digestion

  • PCR-Based Detection: Target unique nucleotide sequences in the nuoA gene

  • Functional Assays: Measure substrate specificity or inhibitor sensitivity differences

What are the current methodological approaches for studying the functional role of nuoA in Shigella dysenteriae?

Researchers employ various methodological approaches to study the functional role of nuoA in Shigella dysenteriae:

Genetic Manipulation Approaches:

  • Gene Knockout: Create ΔnuoA mutants using homologous recombination or CRISPR-Cas systems

  • Complementation Studies: Reintroduce wild-type or mutated nuoA to knockout strains

  • Conditional Expression: Use inducible promoters to control nuoA expression levels

  • Site-Directed Mutagenesis: Target specific residues to identify functional domains

Functional Characterization:

  • Membrane Potential Measurements: Use fluorescent dyes (e.g., DiSC3(5)) to assess changes in membrane potential

  • NADH Oxidation Assays: Measure NADH consumption rates spectrophotometrically

  • Oxygen Consumption: Monitor respiratory activity using oxygen electrodes

  • Sodium Transport: Use Na+-sensitive fluorescent indicators or isotope-based assays

Phenotypic Analysis:

  • Growth Studies: Compare growth curves of wild-type and nuoA mutants under various conditions

  • Stress Response: Evaluate sensitivity to oxidative stress, pH changes, or antibiotic exposure

  • Virulence Assays: Assess effects on invasion, intracellular survival, or host cell cytotoxicity

  • Metabolic Profiling: Use metabolomics to identify changes in metabolite levels

Structural Studies:

  • Protein-Protein Interaction: Investigate associations with other respiratory complex components

  • Membrane Localization: Use fluorescent protein fusions or immunolabeling to visualize localization

  • Conformational Changes: Apply spectroscopic methods to study structural dynamics

What are the emerging research questions regarding nuoA's role in antimicrobial resistance mechanisms of Shigella dysenteriae?

Emerging research questions about nuoA's role in antimicrobial resistance mechanisms include:

  • Energy-Dependent Efflux Systems: How does nuoA-generated energy contribute to the function of drug efflux pumps? Research indicates that respiratory chain components provide the necessary energy for efflux systems that expel antibiotics from bacterial cells .

  • Metabolic Adaptation: Does nuoA function change during antibiotic exposure, potentially allowing metabolic remodeling that contributes to tolerance or persistence?

  • Membrane Potential Modulation: How do changes in membrane potential mediated by nuoA affect the uptake and efficacy of cationic antimicrobial compounds?

  • Biofilm Formation: What is the contribution of nuoA to energy requirements during biofilm formation, a known contributor to antibiotic tolerance?

  • Hypoxic Adaptation: How does nuoA function under oxygen-limited conditions (such as in host tissues or abscesses), and does this contribute to antibiotic tolerance in these environments?

Methodological approaches to address these questions might include:

  • Comparative transcriptomics of wild-type and nuoA mutants under antibiotic exposure

  • Measurement of intracellular antibiotic concentrations in relation to nuoA expression levels

  • Evaluation of membrane potential dynamics during antibiotic challenge

  • Analysis of respiratory chain remodeling during adaptation to antimicrobial pressure

How can structural insights into nuoA contribute to vaccine development against Shigella dysenteriae?

While nuoA has not traditionally been a primary vaccine target, recent research on membrane proteins suggests potential applications:

Potential Vaccine Applications:

  • Component of Multi-Epitope Vaccines: Epitopes from conserved regions of nuoA could be incorporated into multi-epitope vaccines alongside more traditional antigens

  • Adjuvant Carrier Systems: Modified GMMA (Generalized Modules for Membrane Antigens) containing nuoA could serve as both antigen and adjuvant systems

  • Cross-Protection Potential: Due to conservation among Shigella species, nuoA-based approaches might provide broader protection against multiple serotypes

Structural Considerations for Vaccine Design:

  • Epitope Mapping: Identify surface-exposed domains of nuoA accessible to antibodies

  • Conformational Requirements: Determine if native conformation is necessary for protective immune responses

  • Stability Engineering: Modify protein structure to enhance stability and immunogenicity

Methodological Approaches:

  • Computational Epitope Prediction: Use bioinformatics to identify potential B and T cell epitopes

  • Recombinant Expression Systems: Develop systems that maintain proper folding of membrane domains

  • GMMA Technology Integration: Incorporate nuoA into GMMA-based vaccine delivery systems

  • Animal Model Validation: Test candidate formulations in appropriate animal models of shigellosis

What are the most common technical difficulties in working with recombinant Shigella dysenteriae nuoA and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant nuoA:

ChallengeCauseSolution
Low expression yieldMembrane protein toxicity to host cellsUse tunable expression systems; lower induction temperature; use specialized E. coli strains like C41(DE3) designed for membrane proteins
Protein aggregationImproper folding of hydrophobic domainsInclude appropriate detergents during extraction; optimize buffer conditions; use solubility-enhancing fusion partners
Loss of activityDenaturation during purificationMaintain native-like environment with lipids or amphipols; avoid harsh detergents; minimize time between extraction and assay
Reconstitution difficultiesChallenges in membrane insertionUse gradual detergent removal techniques; employ liposome reconstitution with proper lipid composition; try nanodiscs for stability
Storage instabilityProtein degradation or aggregationAdd stabilizers like glycerol and trehalose; store in small aliquots; avoid freeze-thaw cycles

Methodological Strategies:

  • Expression Optimization:

    • Screen multiple expression conditions (temperature, inducer concentration, duration)

    • Test different E. coli strains specialized for membrane proteins

    • Consider cell-free expression systems for toxic proteins

  • Purification Refinement:

    • Implement detergent screening to identify optimal extraction conditions

    • Use affinity chromatography followed by size exclusion to remove aggregates

    • Consider on-column refolding for inclusion body-derived protein

  • Activity Preservation:

    • Maintain cold chain throughout purification

    • Include protease inhibitors to prevent degradation

    • Validate protein integrity through circular dichroism or fluorescence spectroscopy

How can researchers overcome challenges in designing experiments to study nuoA function in the context of the complete NADH-quinone oxidoreductase complex?

Studying nuoA within its native complex presents significant challenges that require specialized approaches:

Experimental Design Considerations:

  • Subunit Interdependence:

    • Challenge: nuoA function depends on interactions with other subunits

    • Solution: Create partial complexes with key interacting partners rather than studying nuoA in isolation

    • Methodology: Co-express nuoA with adjacent subunits; use tandem affinity purification to isolate intact subcomplexes

  • Membrane Environment Requirements:

    • Challenge: Native lipid environment is critical for proper function

    • Solution: Reconstitute purified complexes in artificial membranes

    • Methodology: Use proteoliposomes, nanodiscs, or styrene-maleic acid lipid particles (SMALPs) to maintain native-like membrane environment

  • Functional Assay Complexity:

    • Challenge: Measuring electron transfer coupled to ion translocation requires sophisticated assays

    • Solution: Develop compartmentalized systems that allow measurement of both activities

    • Methodology: Create sealed membrane vesicles with entrapped indicators for ion movement; use rapid kinetic methods to correlate electron transfer with ion translocation

  • Genetic Manipulation Limitations:

    • Challenge: Complete knockout of nuoA may disrupt assembly of the entire complex

    • Solution: Use conditional or partial depletion approaches

    • Methodology: Employ degron-based systems for controlled protein degradation; use site-specific mutations that affect function but not assembly

These methodological approaches provide researchers with practical solutions to the complex challenges involved in studying NADH-quinone oxidoreductase subunit A in Shigella dysenteriae, facilitating more comprehensive understanding of this important bacterial respiratory complex component.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.