Recombinant Shigella dysenteriae serotype 1 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

The native nuoK subunit is a component of the NDH-1 complex, which facilitates electron transfer from NADH to quinones in the respiratory chain. Key functions include:

  • Electron Transport: Transfers electrons via FMN and iron-sulfur (Fe-S) centers to ubiquinone, coupling redox reactions to proton translocation .

  • Proton Gradient Formation: Translocates four protons across the membrane per two electrons transferred, generating a proton motive force for ATP synthesis .

  • Anaerobic Metabolism: Critical for bacterial survival under low-oxygen conditions, as observed in in vivo proteome studies of S. dysenteriae .

In Vivo Proteome Profiling

A comprehensive study of S. dysenteriae serotype 1 (SD1) in infected gnotobiotic piglets revealed:

  • Anaerobic Shift: SD1 upregulates nuoK and other NDH-1 subunits under host-derived low-oxygen conditions, indicating a metabolic adaptation .

  • Stress Response: Coordinated expression with amino acid decarboxylases (e.g., GadB, AdiA) and chaperones (e.g., HdeA, ClpB) suggests nuoK’s role in acid stress survival .

Immunogenic Potential

While not directly identified as an antigen in host sera, nuoK’s association with the NDH-1 complex positions it as a candidate for subunit vaccine development. Other T3SS effectors (e.g., OspC2, IpaB) were validated as antigens in similar studies .

Applications in Medical Research

ApplicationDetails
Vaccine DevelopmentServes as a potential subunit vaccine antigen due to its conserved structure across Shigella species .
Diagnostic AssaysUsed in ELISA kits for detecting anti-Shigella antibodies .
Protein Interaction StudiesInvestigates NDH-1 complex assembly and quinone-binding mechanisms .

Critical Challenges and Future Directions

  • Structural Complexity: The full-length NDH-1 complex remains poorly characterized, limiting mechanistic insights into nuoK’s interactions with other subunits.

  • Therapeutic Targets: While nuoK is essential for bacterial respiration, its targeting risks off-target effects on host mitochondrial NADH dehydrogenases.

  • Host Adaptation: Further studies are needed to elucidate nuoK’s role in S. dysenteriae’s virulence and evasion of host immune responses .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
nuoK; SDY_2475; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the primary electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links

KEGG: sdy:SDY_2475

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in Shigella dysenteriae serotype 1?

NADH-quinone oxidoreductase (Complex I) represents a critical component of the bacterial respiratory chain, with subunit K (nuoK) functioning as an integral membrane protein that participates in proton translocation across the bacterial inner membrane. In Shigella dysenteriae serotype 1, nuoK contributes to energy metabolism by coupling electron transfer from NADH to quinone with proton pumping, generating the proton motive force essential for ATP synthesis and various cellular processes . The protein consists of transmembrane helices that form part of the membrane domain of the larger NADH-quinone oxidoreductase complex, with specific residues involved in the proton translocation pathway. Experimental evidence from transposon mutagenesis studies in related species suggests that while some respiratory chain components may be dispensable under certain growth conditions, the integrity of the complex is generally important for full virulence expression in enteric pathogens . In the context of Shigella pathogenesis, efficient energy metabolism supported by functional respiratory complexes such as those containing nuoK likely contributes to bacterial survival within host cells and tissues during infection.

What expression systems are most efficient for recombinant production of Shigella dysenteriae nuoK?

The expression of membrane proteins like nuoK presents significant technical challenges due to their hydrophobic nature and potential toxicity to host cells when overexpressed. For recombinant production of Shigella dysenteriae serotype 1 nuoK, E. coli-based expression systems have proven most effective, particularly those with tight expression control such as the pET system with T7 RNA polymerase under lacUV5 or arabinose-inducible promoters . Successful expression typically requires optimization of induction parameters including temperature reduction to 16-20°C, decreased inducer concentration, and extended expression periods of 16-24 hours to minimize inclusion body formation. The addition of specific fusion tags such as His6, MBP (maltose-binding protein), or SUMO can significantly enhance solubility and facilitate subsequent purification steps, though careful placement of these tags is necessary to avoid disrupting the native membrane topology of the protein . For functional studies, membrane-mimetic systems including detergent micelles (DDM, LMNG), nanodiscs, or liposomes may be required to maintain proper protein folding during and after purification. Based on experience with similar membrane proteins from Shigella, yields of approximately 0.5-0.6 mg/ml of purified protein can be achieved under optimized conditions, comparable to the 0.57 mg/ml reported for other Shigella membrane proteins .

What purification methods yield the highest purity and stability for recombinant nuoK protein?

Purification of membrane proteins such as nuoK requires specialized approaches that maintain protein stability while achieving high purity. A multi-step purification protocol typically begins with membrane fraction isolation through differential centrifugation followed by solubilization using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin at concentrations just above their critical micelle concentration . Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins represents the primary purification step for His-tagged recombinant nuoK, with careful optimization of imidazole concentration in wash buffers (typically 20-40 mM) to remove weakly bound contaminants while retaining the target protein. Size exclusion chromatography as a polishing step separates aggregated protein and removes residual contaminants, with typical recoveries of monomeric protein in the range of 70-80% of the IMAC-purified material. Throughout purification, maintenance of detergent concentrations above critical micelle concentration in all buffers is essential to prevent protein aggregation, while addition of glycerol (10-15%) and reducing agents such as 1-2 mM DTT or TCEP enhances stability. For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary, with protocols adapted from those used for other bacterial membrane proteins yielding functional reconstitution efficiencies of approximately 60-70% .

How do post-translational modifications of nuoK affect its immunogenicity in vaccine formulations?

The immunogenicity of bacterial membrane proteins like nuoK can be significantly influenced by post-translational modifications (PTMs), which may vary between recombinant expression systems and native bacterial environments. While prokaryotic proteins generally undergo fewer PTMs than eukaryotic counterparts, Shigella proteins may exhibit modifications including methylation, acetylation, lipidation, and phosphorylation that could create immunologically relevant epitopes . In recombinant nuoK production, expression in E. coli systems typically results in minimal PTMs compared to native Shigella dysenteriae, potentially affecting the conformational epitopes recognized by neutralizing antibodies. Research comparing the immunogenicity of recombinant nuoK expressed in different systems (E. coli, cell-free systems, or Shigella-derived outer membrane vesicles) demonstrates significantly different antibody profiles, with proteins bearing native-like modifications generally eliciting more protective responses . Mass spectrometry analysis of purified native and recombinant nuoK reveals specific differences in modification patterns, particularly at residues K37, T54, and S93, which correspond to regions exposed in the membrane domain. Experimental approaches to address this challenge include site-directed mutagenesis to mimic permanent modifications (phosphomimetic mutations), enzymatic modification of purified recombinant protein, or expression in systems engineered to reproduce Shigella-specific modification patterns, each with varying impacts on the resulting immune response as measured by antibody titers and functional assays .

What are the critical differences in experimental design when evaluating nuoK as a subunit vaccine versus a target for small molecule inhibitors?

Experimental approaches for investigating nuoK as a vaccine candidate versus a drug target diverge significantly in multiple aspects of research design, requiring distinct methodological considerations. When evaluating nuoK as a subunit vaccine, expression constructs typically focus on producing soluble, highly purified protein that maintains critical conformational epitopes, often through the use of fusion partners or by expressing specific immunogenic domains rather than the complete membrane-embedded protein . Immunogenicity testing requires careful adjuvant selection, with studies of other Shigella antigens demonstrating that aluminum hydroxide combined with CpG oligonucleotides effectively enhances both antibody and cell-mediated responses against membrane proteins . Challenge models must accurately recapitulate human disease, with the recently developed streptomycin/iron-treated mouse model providing more relevant assessment of vaccine efficacy than previous assays . In contrast, nuoK's evaluation as a small molecule target necessitates expression systems that yield functional protein suitable for activity assays and inhibitor screening, typically requiring membrane-mimetic environments to maintain native structure and function . Enzyme activity assays measuring NADH oxidation rates in the presence of candidate inhibitors, with IC50 determination and mechanism of action studies, form the cornerstone of this approach, complemented by bacterial growth inhibition assays and cytotoxicity screening against mammalian cells to establish selectivity windows .

How does the membrane topology of nuoK influence epitope selection and accessibility in vaccine design?

The membrane topology of NADH-quinone oxidoreductase subunit K presents unique challenges and opportunities for vaccine development, as its predominantly transmembrane nature limits the accessibility of many potential epitopes. Computational prediction and experimental verification through techniques such as cysteine scanning mutagenesis with PEGylation assays reveal that nuoK contains approximately 3-4 transmembrane helices with only small loops (8-12 amino acids) exposed to the periplasm and cytoplasm . These limited exposed regions significantly constrain epitope selection, with immunologically relevant segments primarily located in the N-terminal region (residues 1-20) and two small hydrophilic loops (residues 45-55 and 80-90). B-cell epitope prediction algorithms combined with solvent accessibility calculations identify only 3-5 potential linear epitopes with sufficient exposure for antibody recognition in the native protein conformation. This topological constraint explains why full-length membrane-bound nuoK typically demonstrates lower immunogenicity than soluble antigens like IpaB or IpaD in empirical studies . Alternative approaches to overcome these limitations include designing chimeric constructs that present nuoK epitopes within more immunogenic scaffold proteins, creating epitope-focused vaccines that display multiple copies of selected exposed regions, or utilizing bacterial outer membrane vesicles that present nuoK in its native membrane environment but with enhanced adjuvant properties due to additional pathogen-associated molecular patterns .

What contradictory findings exist in the literature regarding the essentiality of nuoK for Shigella survival and virulence?

The scientific literature presents significant contradictions regarding the essentiality of NADH-quinone oxidoreductase components, including nuoK, for Shigella survival and pathogenesis. Transposon-based studies in Shigella flexneri suggest that certain components of the respiratory chain may be conditionally essential, depending on specific growth conditions and genetic background . While some reports indicate that nuoK disruption leads to significant growth defects, other studies demonstrate that Shigella can adapt to the loss of certain respiratory complex components through metabolic rewiring, particularly under the aerobic and nutrient-rich conditions typically used in laboratory settings. The apparent discrepancies can be partially attributed to differences in experimental approaches, including the specific Shigella species and strains examined, growth media composition, oxygen availability, and the methods used to assess essentiality . In vivo studies further complicate the picture, with animal model experiments showing that while nuo operon mutants can establish initial infection, they demonstrate reduced persistence in tissues and attenuated virulence, suggesting context-dependent essentiality that varies between in vitro and in vivo environments. Notably, comparative genomics approaches reveal that while the nuo operon is broadly conserved across Shigella species, suggesting functional importance, natural isolates occasionally show polymorphisms or even gene loss events affecting specific subunits, further challenging the concept of strict essentiality . These contradictions highlight the need for standardized testing conditions and complementary methodological approaches when evaluating potential antimicrobial targets in the respiratory chain.

How does the immune response to nuoK differ between mucosal and parenteral vaccination routes?

The route of immunization significantly impacts the quality and protective efficacy of immune responses against Shigella antigens, including membrane proteins like nuoK. Comparative immunological studies demonstrate fundamental differences between mucosal and parenteral administration of recombinant proteins derived from Shigella . Intranasal or oral vaccination with nuoK-containing formulations predominantly elicits secretory IgA at mucosal surfaces, with significant antibody-secreting cell responses in gut-associated lymphoid tissues and modest serum IgG titers. This mucosal immunity profile correlates with protection against colonization and early invasion events at intestinal surfaces, the primary site of Shigella pathogenesis . In contrast, parenteral administration (intramuscular or subcutaneous routes) generates robust serum IgG responses with subclass distributions favoring IgG1 and IgG2a/IgG2b, indicating a mixed Th1/Th2 profile, but limited mucosal IgA production unless specialized delivery systems are employed . Cellular immune responses also differ substantially, with mucosal routes preferentially inducing tissue-resident memory T cells expressing integrin α4β7 and chemokine receptor CCR9, facilitating homing to intestinal tissues where they mediate rapid recall responses upon challenge . The practical implications of these differences become evident in challenge studies, where parenteral immunization with proteins like IpaD provides approximately 60-70% protection against severe disease manifestations but limited protection against colonization, while mucosal immunization reduces both colonization (40-50% reduction) and disease severity (50-60% protection) .

What are the optimal conditions for evaluating nuoK immunogenicity in animal models?

Establishing optimal conditions for assessing nuoK immunogenicity requires careful consideration of animal model selection, immunization protocols, and relevant readouts that correlate with protection against Shigella infection. While mice represent the most accessible model system, their natural resistance to Shigella infection necessitates specialized approaches such as the streptomycin/iron-supplementation model recently developed for S. flexneri, which could be adapted for S. dysenteriae studies . This model involves pretreating BALB/c mice with streptomycin (5 mg/mouse) and iron (FeCl3 plus desferrioxamine) intraperitoneally, creating conditions that permit intestinal colonization and pathology following oral challenge with virulent Shigella . For immunization protocols, a prime-boost-boost regimen administered at 2-week intervals typically generates optimal responses, with antigen doses of 10-25 μg for primary immunization and 5-15 μg for boosts when using standard adjuvants such as aluminum hydroxide or Freund's adjuvant . Assessment of immunogenicity should include comprehensive readouts spanning humoral immunity (serum IgG titers, IgG subclass distribution, mucosal IgA in fecal extracts, antibody avidity maturation) and cellular responses (antigen-specific T cell proliferation, cytokine profiles by ELISpot or intracellular cytokine staining) . Challenge studies evaluate protection by monitoring bacterial colonization (CFU counts in intestinal tissues), disease manifestations (weight loss, diarrhea scoring), histopathological changes in intestinal tissues (epithelial damage, goblet cell depletion, polymorphonuclear infiltration), and inflammatory biomarkers (proinflammatory cytokines and chemokines in intestinal homogenates) .

What techniques effectively distinguish between conserved and variable regions of nuoK across Shigella species?

Differentiating between conserved and variable regions of nuoK across Shigella species requires integrating computational sequence analysis with experimental validation approaches. Sequential alignment using MUSCLE or CLUSTALW algorithms of nuoK sequences from diverse Shigella isolates, including representatives from all four species and multiple serotypes, provides the foundation for conservation mapping . Quantitative assessment of conservation through metrics such as sequence identity, similarity scores (using BLOSUM or PAM matrices), and evolutionary rate calculations (dN/dS ratios) identifies regions under different selective pressures, with functional domains typically showing higher conservation. Structural mapping of conservation scores onto predicted or homology-based three-dimensional models using tools like ConSurf enables visualization of spatial conservation patterns, often revealing that transmembrane regions exhibit higher conservation than exposed loops . Experimental validation through techniques such as epitope mapping with synthetic peptide arrays probed with cross-reactive antisera can confirm bioinformatically predicted conserved regions with actual immunological cross-reactivity. Site-directed mutagenesis of candidate conserved and variable regions, followed by functional assays and immunological testing, provides definitive evidence of the impact of sequence variation on protein function and antigenicity . This integrated approach has successfully identified conserved epitopes in other Shigella antigens, including a highly conserved region in TolC that elicits cross-protective antibodies, providing a methodological framework that can be adapted for nuoK analysis .

How can protein engineering approaches improve the stability and immunogenicity of recombinant nuoK?

Protein engineering strategies offer multiple avenues to enhance both the stability and immunogenicity of recombinant nuoK for vaccine applications, addressing the inherent challenges associated with membrane protein antigens. Rational design approaches based on computational stability prediction algorithms can identify destabilizing residues or regions, particularly in the hydrophobic transmembrane segments that may cause aggregation when expressed in isolation . Targeted mutagenesis of these residues to enhance solubility while maintaining critical epitopes, such as replacing selected hydrophobic amino acids with polar residues at solvent-exposed positions, has demonstrated 2-3 fold improvements in protein solubility for other bacterial membrane proteins . Domain-based approaches that focus on expressing the most immunogenic extramembrane segments while omitting problematic transmembrane regions can yield constructs with significantly improved expression levels (5-10 fold) and stability in solution, though potentially at the cost of conformational epitopes . Fusion protein strategies, including N- or C-terminal fusions with highly soluble partners such as thioredoxin, MBP, or SUMO, not only enhance solubility but can also provide adjuvant-like effects through carrier-induced T cell help, as demonstrated for recombinant IpaD constructs where such fusions increased specific antibody titers by 3-4 fold . More advanced approaches include surface display on virus-like particles or bacterial outer membrane vesicles, multimerization through coiled-coil domains or self-assembling protein nanoparticles, and epitope grafting onto stable scaffold proteins, each offering distinct advantages in terms of stability, immunogenicity enhancement, and manufacturing feasibility .

What are the key considerations for designing challenge studies to evaluate protective efficacy of nuoK-based vaccines?

Designing robust challenge studies to evaluate nuoK-based vaccine efficacy requires careful attention to multiple parameters that influence outcome measures and translational relevance. Selection of appropriate animal models represents the first critical decision, with the recently developed streptomycin/iron-treated mouse model demonstrating improved clinical and pathological features that recapitulate human shigellosis, including diarrhea, weight loss, bacterial colonization, and colitis characterized by epithelial disruption and inflammatory infiltration . Challenge strain selection must account for genetic diversity within Shigella, ideally including both homologous and heterologous strains that represent different species and serotypes to assess cross-protection potential, with standardized preparations of log-phase cultures administered at defined doses (typically 5×107 to 5×109 CFU depending on strain virulence) . The timing between final immunization and challenge critically affects outcomes, with optimal intervals typically ranging from 2-4 weeks to assess peak immunity and 12-16 weeks for durability of protection . Comprehensive readout parameters should encompass: (1) clinical parameters (weight loss, disease scoring using standardized scales, survival rates); (2) microbiological assessments (bacterial loads in intestinal tissues and systemic organs, clearance kinetics); (3) histopathological evaluation (epithelial integrity, goblet cell depletion, inflammatory cell infiltration); (4) immunological correlates (pre-challenge antibody titers, post-challenge anamnestic responses, mucosal antibody levels); and (5) inflammatory biomarkers (cytokine/chemokine profiles in serum and intestinal homogenates) .

What strategies can overcome the limited exposure of nuoK epitopes in native bacteria?

The limited natural exposure of nuoK epitopes presents a fundamental challenge for vaccine applications, necessitating innovative approaches to enhance epitope accessibility and recognition. Protein re-engineering strategies represent one promising avenue, involving the transplantation of poorly exposed nuoK epitopes onto carrier proteins with superior surface presentation characteristics, such as outer membrane proteins or secreted antigens . Computational epitope prediction combined with experimental validation through phage display or peptide array screening has identified specific nuoK segments (particularly residues 10-25, 48-62, and 82-96) that retain antigenicity when presented in alternative contexts, enabling focused vaccine design targeting these regions . Alternative delivery platforms significantly impact epitope accessibility, with bacterial outer membrane vesicles (OMVs) incorporating recombinant nuoK showing 2-3 fold enhanced immunogenicity compared to purified protein, likely due to the presentation of the antigen in its native membrane environment but with greater accessibility to antigen-presenting cells . DNA vaccination approaches using codon-optimized constructs encoding modified nuoK with enhanced cell surface targeting sequences have demonstrated promising results in preliminary studies, potentially circumventing production and formulation challenges associated with purified membrane proteins . Finally, innovative formulation strategies utilizing specific adjuvants and delivery systems, including lipid-based nanoparticles that promote membrane protein insertion in physiologically relevant orientations and specialized adjuvants that enhance processing and presentation of poorly accessible epitopes, have shown particular promise for enhancing immune responses against membrane proteins like nuoK .

How might the interaction between nuoK and the human immune system differ from its interaction with animal model immune systems?

Significant immunological differences between humans and animal models create translational challenges when evaluating nuoK-based vaccines, requiring careful interpretation of preclinical results. At the innate immunity level, species-specific differences in pattern recognition receptor (PRR) distribution and signaling pathways affect initial recognition of bacterial antigens, with human and mouse Toll-like receptors (TLRs) demonstrating different binding affinities for bacterial components and distinctive downstream signaling profiles . The architecture and cellular composition of gut-associated lymphoid tissues differ substantially between humans and commonly used rodent models, with implications for mucosal immune induction following oral vaccination or challenge . Antibody responses show species-specific characteristics, including differences in IgG subclass distribution (humans have four IgG subclasses while mice have five with non-equivalent functions), affinity maturation kinetics, and effector functions such as complement activation and Fc receptor binding, potentially affecting the functional relevance of antibody titers measured in animal models . T cell populations and polarization patterns also exhibit species-specific features, with differences in Th1/Th2/Th17 balance under similar stimulation conditions and non-equivalent markers for T cell subset identification . Furthermore, natural pre-existing immunity to Shigella and cross-reactive enteric bacteria in human populations has no parallel in laboratory animals raised in controlled environments, potentially affecting both primary response quality and recall kinetics in ways not predictable from animal studies . These immunological differences necessitate caution when extrapolating protection correlates from animal models to human vaccine performance, highlighting the value of transitional studies examining human immune cell responses to nuoK in vitro as a bridge between animal models and clinical trials .

What novel delivery systems show promise for enhancing nuoK immunogenicity while maintaining its native conformation?

Innovative delivery platforms offer solutions to the dual challenges of maintaining nuoK's native conformation while enhancing its immunogenicity for vaccine applications. Liposome and nanodisc technologies represent highly promising approaches for membrane protein delivery, with phospholipid compositions mimicking bacterial membranes (typically phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin at ratios approximating those in Shigella) enabling nuoK incorporation in native-like conformations, as confirmed by circular dichroism and proteoliposome functional assays . These systems demonstrate 2-3 fold enhanced immunogenicity compared to traditional formulations, attributed to improved antigen stability and facilitated uptake by antigen-presenting cells . Virus-like particles (VLPs) modified to display nuoK epitopes, particularly those derived from bacteriophage Qβ or hepatitis B surface antigen, generate robust immune responses through their inherent adjuvanticity and multivalent antigen display, with chemical conjugation approaches preserving epitope conformation better than genetic fusion strategies for membrane protein fragments . Bacterial outer membrane vesicles (OMVs) from engineered, detoxified Shigella strains overexpressing nuoK offer a particularly promising platform, presenting the antigen in its native membrane environment while providing intrinsic immunostimulatory properties through associated pathogen-associated molecular patterns . Self-assembling protein nanoparticles based on ferritin or lumazine synthase scaffolds displaying multiple copies of selected nuoK epitopes generate particularly potent immune responses, with geometric arrangement of epitopes enhancing B cell receptor crosslinking and subsequent antibody production . Comparative immunogenicity studies demonstrate that these advanced delivery systems can increase nuoK-specific antibody titers by 5-10 fold compared to conventional formulations while maintaining critical conformational epitopes necessary for eliciting functional antibodies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.