Recombinant Shigella dysenteriae serotype 1 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a particular tag, please specify it for preferential development.
Synonyms
aaeA; SDY_3417; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: sdy:SDY_3417

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of the AaeA efflux pump subunit in Shigella dysenteriae?

The AaeA subunit (previously known as YhcQ) is a membrane fusion protein that forms part of the AaeAB efflux system in Shigella dysenteriae serotype 1. This efflux system functions primarily to export aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA), from the bacterial cell . The AaeA protein works in conjunction with AaeB (previously YhcP) to form a functional efflux pump that protects the bacterium from potentially toxic effects of these compounds.

The physiological significance of this system lies in its role as a "metabolic relief valve" that alleviates toxic effects resulting from imbalanced metabolism . When excess metabolites like pHBA accumulate within the cell, they can disrupt normal cellular functions. The AaeAB system responds to this accumulation by upregulating expression and actively pumping out these compounds, thus maintaining cellular homeostasis.

Experimentally, the function of AaeA has been demonstrated through mutation studies showing that yhcP (aaeB) mutant strains exhibit hypersensitivity to pHBA. Furthermore, expression of both yhcQ (aaeA) and yhcP (aaeB) together was necessary and sufficient to suppress this hypersensitivity .

How does the AaeA subunit differ from other efflux pump components in gram-negative bacteria?

The AaeA subunit belongs to the membrane fusion protein (MFP) family, which is distinct from the putative efflux transport (PET) protein family that includes AaeB . While many efflux systems in gram-negative bacteria operate as tripartite complexes (including an inner membrane transporter, a membrane fusion protein, and an outer membrane channel), the AaeAB system appears to function as a bipartite complex.

Unlike the well-characterized AcrAB-TolC system, which transports a broad range of substrates including antibiotics, detergents, and dyes, the AaeAB system has a much narrower substrate specificity, primarily targeting aromatic carboxylic acids . Experimental evidence has shown that only a few aromatic carboxylic acids among hundreds of diverse compounds tested were identified as substrates for the AaeAB efflux pump .

Another distinguishing feature is the regulatory mechanism. The AaeAB system is regulated by AaeR (previously YhcS), a LysR-type transcriptional regulator that functions as a positive transcription factor for the aaeXAB operon . This regulation is substrate-specific, with aromatic carboxylic acids serving as inducers of expression.

What methods are used to produce recombinant Shigella dysenteriae AaeA protein for research purposes?

The production of recombinant Shigella dysenteriae AaeA protein typically involves heterologous expression systems. According to available information, several expression hosts can be employed for this purpose:

  • Bacterial Expression Systems: Escherichia coli is commonly used due to its genetic similarity to Shigella and ease of manipulation . The gene encoding AaeA (aaeA) is cloned into an appropriate expression vector containing an inducible promoter.

  • Alternative Expression Systems: Yeast, baculovirus, or mammalian cell systems may also be used, especially when protein folding or post-translational modifications are concerns .

A typical protocol for E. coli-based expression includes:

  • PCR amplification of the aaeA gene from Shigella dysenteriae serotype 1 genomic DNA

  • Cloning into an expression vector with an appropriate tag (His-tag is common for purification purposes)

  • Transformation into an E. coli expression strain

  • Induction of protein expression (often using IPTG for T7-based systems)

  • Cell harvest and lysis

  • Protein purification via affinity chromatography

  • Quality control via SDS-PAGE and Western blotting

Recombinant protein quality is typically assessed through purity analysis, structural integrity verification, and functional assays to confirm retention of native properties.

How can researchers effectively measure the efflux activity of the AaeAB system in Shigella dysenteriae?

Measuring efflux activity of the AaeAB system requires specialized methodologies that can detect the transport of substrates across the bacterial membrane. Several approaches can be employed:

Fluorescence-Based Assays:
Fluorogenic compounds such as fluorescein-di-β-d-galactopyranoside (FDG) can be adapted to measure efflux activity . When FDG enters bacterial cells, it is hydrolyzed by β-galactosidase to produce fluorescein, which is a substrate for efflux pumps. By monitoring the rate of fluorescein accumulation within cells in the presence and absence of efflux inhibitors, researchers can quantify efflux activity.

Radioactive Substrate Accumulation:
Radiolabeled p-hydroxybenzoic acid (pHBA) or other aromatic carboxylic acids can be used to directly measure AaeAB-mediated efflux. This approach involves:

  • Incubating bacterial cells with radiolabeled substrate

  • Removing external substrate by washing

  • Measuring the intracellular accumulation of radiolabeled compounds over time

  • Comparing accumulation in wild-type versus aaeA/aaeB mutant strains

Real-time PCR for Expression Analysis:
The expression levels of aaeA and aaeB can serve as proxies for efflux activity, especially since expression is induced by substrates. qRT-PCR can quantify mRNA levels of these genes under various conditions .

Table 1: Comparison of Methods for Measuring AaeAB Efflux Activity

MethodAdvantagesLimitationsKey Parameters
Fluorescence-based assaysReal-time measurements; non-radioactivePotential interference from other efflux systemsExcitation/emission wavelengths; cell density; substrate concentration
Radioactive substrate accumulationDirect measurement of specific substratesRequires radioactive materials; endpoint measurementsSpecific activity of labeled compound; incubation time; cell number
Gene expression analysisIndicates regulation of efflux systemIndirect measure of activityReference genes for normalization; primer specificity
Growth inhibition assaysSimple to perform; physiologically relevantIndirect measure of effluxGrowth conditions; substrate concentration range
Membrane vesicle transport assaysIsolated system without cellular complexityTechnical complexity; artificial systemVesicle preparation quality; ATP concentration; temperature

What is the structural basis for substrate specificity in the AaeAB efflux system?

The substrate specificity of the AaeAB efflux system is notably narrow compared to other efflux pumps, with only a few aromatic carboxylic acids recognized as substrates . Understanding this specificity requires analysis of the structural features of both the pump and its substrates.

Structural Determinants in AaeA and AaeB:
While comprehensive structural data specific to the AaeAB system is limited, inferences can be made based on related proteins. The AaeB protein (previously YhcP) belongs to the putative efflux transport (PET) family and is predicted to have 12 transmembrane segments . These segments likely form a substrate-binding pocket with specific amino acid residues that interact with aromatic carboxylic acids.

The AaeA protein (previously YhcQ) is a member of the membrane fusion protein family and facilitates the connection between AaeB and potentially the outer membrane. The membrane fusion proteins typically have a hairpin-like structure with conserved domains that interact with other components of the efflux system .

Substrate Recognition Patterns:
Chemical analysis of known substrates reveals common features:

  • An aromatic ring structure

  • Carboxylic acid moiety

  • Specific positioning of hydroxyl or other groups on the aromatic ring

For example, p-hydroxybenzoic acid has a hydroxyl group at the para position of the benzoic acid structure. This specific arrangement appears critical for recognition by the AaeAB system.

Experimental Approaches for Structural Studies:

  • Site-directed mutagenesis of potential binding site residues

  • Computational docking simulations

  • X-ray crystallography or cryo-electron microscopy of the AaeAB complex

  • Comparative analysis with structurally characterized efflux systems like AcrAB-TolC

How does the expression of AaeA in Shigella dysenteriae respond to environmental and metabolic stresses?

The expression of AaeA is tightly regulated as part of the aaeXAB operon, which is controlled by the LysR-type transcriptional regulator AaeR (previously YhcS) . This regulation responds to various environmental and metabolic conditions:

Substrate-Induced Expression:
The addition of p-hydroxybenzoic acid (pHBA) to bacterial cultures dramatically upregulates the expression of the aaeXAB operon. Experiments have shown up to 145-fold increases in expression at 50 mM pHBA . This response follows a dose-dependent pattern, with higher concentrations of pHBA inducing greater expression up to sub-lethal levels.

Metabolic Stress Response:
The physiological role of the AaeAB system as a "metabolic relief valve" suggests that its expression may increase during conditions that lead to imbalanced metabolism . Such conditions might include:

  • Oxygen limitation

  • Carbon source shifts

  • Growth phase transitions

  • Exposure to metabolic inhibitors

Regulation Mechanism:
The regulatory mechanism involves AaeR binding to aromatic carboxylic acids, which causes a conformational change that allows AaeR to bind to the promoter region of the aaeXAB operon and activate transcription . This mechanism ensures that the efflux system is expressed only when needed.

Table 2: Expression Levels of aaeA Under Various Conditions

ConditionRelative Expression (Fold Change)Experimental SystemReference
No pHBA (baseline)1.0E. coli with yhcRQP-luxCDABE fusionVan Dyk et al., 2004
5 mM pHBA~20-fold increaseE. coli with yhcRQP-luxCDABE fusionVan Dyk et al., 2004
10 mM pHBA~50-fold increaseE. coli with yhcRQP-luxCDABE fusionVan Dyk et al., 2004
25 mM pHBA~100-fold increaseE. coli with yhcRQP-luxCDABE fusionVan Dyk et al., 2004
50 mM pHBA~145-fold increaseE. coli with yhcRQP-luxCDABE fusionVan Dyk et al., 2004
100 mM pHBAReduced expression (toxic effects)E. coli with yhcRQP-luxCDABE fusionVan Dyk et al., 2004
yhcS (aaeR) mutationAlmost complete elimination of responseE. coli yhcS::TN〈Kan〉 mutantVan Dyk et al., 2004

What are the optimal protocols for expressing and purifying recombinant Shigella dysenteriae AaeA protein?

Successful expression and purification of recombinant Shigella dysenteriae AaeA protein requires careful optimization of multiple parameters. The following protocol provides a comprehensive approach:

Expression System Selection:
E. coli is typically the preferred expression host due to its high yield, rapid growth, and genetic similarity to Shigella . BL21(DE3) or Rosetta strains are commonly used for membrane proteins.

Vector Design Considerations:

  • Include an N-terminal or C-terminal affinity tag (His6, GST, or MBP)

  • Use an inducible promoter system (T7 or araBAD)

  • Incorporate a cleavage site for tag removal if necessary for functional studies

  • Consider codon optimization for the expression host

Expression Protocol:

  • Transform expression vector into E. coli

  • Culture in appropriate media (LB, TB, or minimal media)

  • Grow to mid-log phase (OD600 ≈ 0.6-0.8)

  • Induce protein expression:

    • IPTG (0.1-1.0 mM) for T7 promoter systems

    • L-arabinose (0.002-0.2%) for araBAD promoter systems

  • Continue expression at reduced temperature (16-25°C) for 4-16 hours

  • Harvest cells by centrifugation (5,000 x g, 10 minutes, 4°C)

Membrane Protein Extraction:

  • Resuspend cells in lysis buffer (typically containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF, and protease inhibitor cocktail)

  • Disrupt cells by sonication or French press

  • Remove unbroken cells and debris by centrifugation (10,000 x g, 20 minutes, 4°C)

  • Isolate membranes by ultracentrifugation (100,000 x g, 1 hour, 4°C)

  • Solubilize membrane proteins with detergents:

    • n-Dodecyl β-D-maltoside (DDM, 1-2%)

    • n-Octyl-β-D-glucopyranoside (OG, 2-3%)

    • Digitonin (1-2%)

Purification Strategy:

  • Affinity chromatography:

    • Ni-NTA for His-tagged proteins

    • Glutathione Sepharose for GST-tagged proteins

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for further purification if needed

Quality Control:

  • SDS-PAGE and Western blotting to verify size and purity

  • Mass spectrometry for identity confirmation

  • Dynamic light scattering to assess homogeneity

  • Circular dichroism to evaluate secondary structure

  • Functional assays to confirm activity

How can researchers develop functional assays to test AaeA activity in vitro?

Developing reliable functional assays for AaeA activity requires understanding its role in the efflux process and designing experiments that detect this activity. Several approaches can be employed:

Reconstitution in Proteoliposomes:

  • Purify recombinant AaeA and AaeB proteins

  • Prepare liposomes from E. coli lipids or synthetic phospholipids

  • Reconstitute AaeA and AaeB into liposomes

  • Load proteoliposomes with substrate (e.g., fluorescently labeled pHBA)

  • Measure efflux rates by monitoring substrate release over time

  • Compare with control liposomes lacking AaeA and/or AaeB

Binding Assays:

  • Use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure:

    • AaeA-AaeB interactions

    • AaeA-substrate interactions

    • AaeA-AaeR interactions

  • Calculate binding affinities and kinetic parameters

Bacterial Two-Hybrid System:

  • Construct fusion proteins with AaeA and potential interaction partners

  • Measure reporter gene expression as an indicator of protein-protein interactions

  • Quantify interaction strength through β-galactosidase activity

ATPase Activity Assays:
If the AaeAB system is dependent on ATP hydrolysis:

  • Measure ATPase activity using colorimetric assays (malachite green)

  • Compare basal and substrate-stimulated ATPase rates

  • Test effects of potential inhibitors on ATPase activity

Table 3: Comparison of Functional Assays for AaeA Activity

Assay TypeMeasuresAdvantagesLimitationsControls Needed
Proteoliposome reconstitutionDirect substrate transportIsolated system; quantitativeTechnical complexity; artificial environmentEmpty liposomes; single protein controls
Binding assays (SPR, ITC)Molecular interactionsDirect measurement of affinitiesRequires purified components; no transport measurementNegative binding controls; buffer controls
Bacterial two-hybridProtein-protein interactionsIn vivo measurement; high throughputIndirect measure of functionEmpty vector controls; known interaction pairs
ATPase activityEnergy coupling to transportSimple to perform; quantitativeIndirect measure of transportNo substrate controls; known inhibitors
Fluorescence resonance energy transfer (FRET)Conformational changesReal-time dynamics; in vitro or in vivoRequires protein labelingDonor-only and acceptor-only controls

How should researchers interpret conflicting data regarding AaeA function in different experimental systems?

When faced with conflicting data about AaeA function across different experimental systems, researchers should adopt a systematic approach to reconciliation and interpretation:

Sources of Experimental Variation:

  • Expression System Differences: AaeA function may vary between homologous expression (in Shigella) versus heterologous expression (in E. coli or other hosts) .

  • Protein Tagging Effects: Affinity tags or reporter fusions might affect protein folding, localization, or function.

  • Membrane Composition Variations: Lipid environments differ between organisms and reconstituted systems, potentially affecting protein function.

  • Substrate Concentration Ranges: Studies using different concentration ranges may observe different kinetic properties.

  • Genetic Background Influences: Additional efflux systems or regulatory factors may be present in some strains but not others.

Systematic Reconciliation Approach:

  • Parameter Standardization: Identify and standardize key experimental parameters across studies:

    • Growth conditions

    • Expression levels

    • Substrate concentrations

    • Assay methods

  • Sequential Hypothesis Testing: Develop hypotheses to explain discrepancies and test them systematically:

    • If differences are observed between in vivo and in vitro systems, test if specific cellular factors are required

    • If differences exist between bacterial species, examine species-specific interacting partners

  • Complementary Method Integration: Use multiple methodologies to verify findings:

    • Combine genetic approaches (knockouts, complementation)

    • Biochemical methods (purified protein studies)

    • Structural analyses (if available)

    • Computational predictions

Table 4: Framework for Resolving Conflicting Data on AaeA Function

Conflict TypePotential CausesResolution StrategiesValidation Approaches
In vivo vs. in vitro resultsMissing cofactors; non-physiological conditionsIdentify missing components; adjust experimental conditionsAdd cellular extracts to in vitro systems; use permeabilized cells
E. coli vs. Shigella resultsSpecies-specific partners; regulatory differencesCross-complementation experiments; heterologous expressionChimeric proteins; regulatory element swapping
Substrate specificity discrepanciesAssay sensitivity; concentration effectsStandardize detection methods; use concentration gradientsStructure-activity relationship studies; competition assays
Mutant phenotype variationsStrain background effects; compensatory mechanismsUse isogenic strains; construct multiple mutation typesComplementation studies; inducible expression systems
Protein-protein interaction differencesDetection method limitations; transient interactionsMultiple interaction methods; in situ crosslinkingMutational analysis of interaction interfaces; FRET studies

What computational approaches can be used to predict the interaction network of AaeA in Shigella dysenteriae?

Computational approaches offer powerful tools for predicting the interaction network of AaeA in Shigella dysenteriae, particularly when experimental data is limited. Several methodologies can be employed:

Homology-Based Approaches:

  • Identify AaeA homologs in well-characterized systems (e.g., MFP proteins in E. coli)

  • Transfer known interactions from homologs to AaeA

  • Validate predictions through comparative genomic analyses

  • Assess conservation of interaction interfaces

Structural Modeling and Docking:

  • Generate structural models of AaeA using homology modeling (based on crystal structures of related MFP proteins)

  • Perform molecular docking simulations with:

    • AaeB (efflux pump partner)

    • AaeR (regulatory protein)

    • Potential substrate molecules

  • Evaluate binding energies and interaction surfaces

  • Identify critical residues for interactions

Systems Biology Approaches:

  • Construct gene co-expression networks from transcriptomic data

  • Identify genes with expression patterns correlated with aaeA

  • Perform enrichment analyses to identify biological processes associated with AaeA

Functional Association Networks:

  • Use tools like STRING, GeneMANIA, or Ingenuity Pathway Analysis

  • Integrate multiple evidence types:

    • Co-expression

    • Physical interactions

    • Genetic interactions

    • Co-occurrence across genomes

    • Text mining

Machine Learning Prediction:

  • Train models using known bacterial protein-protein interactions

  • Extract features from sequence, structure, and evolutionary conservation

  • Apply models to predict novel AaeA interactions

  • Validate high-confidence predictions experimentally

Table 5: Computational Tools for AaeA Interaction Network Prediction

ApproachRecommended ToolsInput RequirementsOutput FormatValidation Methods
Homology modelingSWISS-MODEL, Phyre2, I-TASSERAaeA amino acid sequence3D structural modelRMSD to known structures; Ramachandran plot
Molecular dockingHADDOCK, AutoDock, ClusPro3D models of interacting partnersComplex structures; binding energiesMutagenesis of predicted interface residues
Co-expression analysisWGCNA, CEMiToolTranscriptomic datasetsGene modules; correlation networksqRT-PCR validation of co-expressed genes
Functional networksSTRING, GeneMANIAGene/protein identifiersInteraction networks with confidence scoresLiterature validation; small-scale experiments
Machine learningSPRINT, DeepPPI, PIPEProtein sequences; feature vectorsPredicted interactions with probabilitiesCross-validation; experimental verification

What is the role of AaeA in Shigella dysenteriae virulence and host immune response?

The role of AaeA in Shigella dysenteriae virulence represents an emerging area of research with important implications for understanding bacterial pathogenesis and host-pathogen interactions:

Potential Contributions to Virulence:

  • Metabolic Adaptation: By exporting toxic metabolites that accumulate during infection, the AaeAB system may help Shigella adapt to the host environment .

  • Stress Response: During colonization and invasion, bacteria face various stresses that can disrupt metabolism. The efflux function may help maintain cellular homeostasis under these conditions .

  • Host-Derived Antimicrobial Compound Resistance: Host tissues produce various antimicrobial compounds, some of which might be substrates for the AaeAB efflux system.

  • Biofilm Formation: Efflux pumps have been implicated in biofilm formation in other bacteria, which can enhance virulence and persistence.

Immune Recognition and Evasion:
AaeA, as a surface-exposed or membrane-associated protein, could potentially:

Vaccine Development Implications:
The WHO has identified Shigella vaccine development as an important public health goal . As a conserved protein in Shigella dysenteriae serotype 1, AaeA could potentially:

  • Serve as a vaccine antigen or component

  • Be a target for attenuated vaccine strain development

  • Contribute to protective immunity if antibodies against it neutralize bacterial function

Experimental Evidence Gaps:
It should be noted that direct experimental evidence linking AaeA specifically to Shigella virulence remains limited. Further studies are needed to:

  • Evaluate virulence of aaeA mutants in cellular and animal models

  • Determine if AaeA is expressed during human infection

  • Assess immune responses to AaeA during natural infection

  • Test if AaeA-specific antibodies provide protection

How can AaeA be utilized in the development of novel antimicrobial strategies against Shigella dysenteriae?

The AaeA protein and the AaeAB efflux system present several opportunities for developing novel antimicrobial strategies against Shigella dysenteriae:

Efflux Pump Inhibition Approach:

  • Direct Inhibitor Development: Design small molecules that specifically bind to AaeA or AaeB to disable efflux function .

  • Structure-Based Drug Design: Use structural information about AaeA and its interaction with AaeB to develop inhibitors that disrupt complex formation.

  • Evaluation Methods: Utilize fluorescence-based assays to screen potential inhibitor compounds by measuring their effect on efflux activity .

Regulatory Circuit Targeting:

  • Anti-Activator Strategy: Develop compounds that bind to AaeR and prevent its activation by aromatic carboxylic acids .

  • Promoter Competition: Design synthetic transcription factors that compete with AaeR for binding to the aaeXAB promoter region.

Vaccine Development Applications:

  • Recombinant Subunit Vaccines: Use purified recombinant AaeA as an antigen component in vaccine formulations .

  • Live Attenuated Approach: Create Shigella strains with modified AaeA that maintain immunogenicity but reduce virulence.

  • Reverse Vaccinology: Analyze AaeA sequence for potential B-cell and T-cell epitopes to design peptide-based vaccines.

Table 6: Potential Antimicrobial Strategies Targeting AaeA

StrategyMechanismDevelopment StageAdvantagesChallenges
Direct efflux inhibitorsBinding to AaeA/AaeB to block functionConceptual/early screeningReduced resistance potential; potential narrow spectrumMembrane penetration issues; potential toxicity
Anti-activator compoundsPreventing AaeR activationConceptualNovel target; potential for reduced resistanceSpecificity concerns; delivery to cytoplasmic target
Competitive substrate analogsOccupying binding site without being transportedEarly researchStructure-activity relationship establishedCross-reactivity with human transporters; efficacy concerns
Recombinant protein vaccinesGenerating antibodies against AaeAPreclinical modelsPotential broad protection; reduced antimicrobial resistanceAdjuvant requirements; protein stability issues
DNA vaccinesIn vivo expression of AaeAExperimentalStrong cellular immune response; stabilityDelivery system needs; expression variability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.