Recombinant Shigella dysenteriae serotype 1 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; SDY_0631; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
kdpC
Target Protein Sequence
MSGLRPAISTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT DNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDTSTSVPAEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function
The KdpC subunit is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Functionally, KdpC acts as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links

KEGG: sdy:SDY_0631

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biological significance of kdpC in Shigella dysenteriae serotype 1?

The Potassium-transporting ATPase C chain (kdpC) is a critical component of the high-affinity potassium transport system in Shigella dysenteriae serotype 1. This protein forms part of the KdpFABC complex, which functions as an emergency K⁺ uptake system under conditions of potassium limitation. The kdpC subunit plays a crucial role in maintaining bacterial osmotic homeostasis and is essential for bacterial survival under potassium-limited conditions. In S. dysenteriae serotype 1, which produces Shiga toxin and causes the most severe illness and highest mortality among Shigella species, the kdpC protein may indirectly contribute to virulence by enabling bacterial persistence in potassium-limited host environments .

How does the structure of kdpC relate to its function in potassium transport?

The kdpC protein functions as an essential subunit of the KdpFABC complex, where it associates closely with kdpB (the catalytic subunit) and contributes to the stability and proper assembly of the transport complex. Structurally, kdpC contains transmembrane domains that anchor it within the bacterial membrane and cytoplasmic regions that interact with other components of the complex. These structural features enable kdpC to participate in conformational changes during the potassium transport cycle. While not directly involved in ATP hydrolysis like kdpB, the kdpC subunit plays a critical role in coupling energy from ATP hydrolysis to potassium transport across the membrane, making it an integral part of this high-affinity transport system .

What expression systems are most suitable for producing recombinant S. dysenteriae kdpC?

For the expression of recombinant S. dysenteriae kdpC, several microbial host systems have proven effective, with E. coli being the most widely used due to its genetic similarity to Shigella and established protocols. The selection of an appropriate expression system depends on research objectives:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coli BL21(DE3)High yield, economical, rapid growthPossible inclusion body formationInitial expression trials, structural studies
E. coli C43(DE3)Better for membrane proteins, reduced toxicityLower yields than BL21Functional studies requiring properly folded protein
Cell-free systemsAvoids toxicity issues, rapid resultsHigher cost, lower scaleProtein-protein interaction studies
Yeast systemsPost-translational modifications, proper foldingLonger development timeStudies requiring eukaryotic processing

The choice of vector is equally important, with pET systems offering strong induction control through the T7 promoter, while pBAD vectors provide more fine-tuned expression through arabinose induction, which can be beneficial for potentially toxic membrane proteins like kdpC .

What are the optimal conditions for solubilizing and purifying recombinant kdpC?

Purification of recombinant kdpC presents challenges typical of membrane proteins. The following methodology has been optimized through Design of Experiments (DoE) approaches:

  • Initial Extraction: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration (CMC) for initial solubilization.

  • Detergent Screening: A systematic screening of detergents is recommended using the following optimized conditions:

DetergentOptimal ConcentrationIncubation TemperatureIncubation TimeRelative Yield
DDM1-1.5%4°C2-4 hours+++
LMNG0.5-1%4°C2-4 hours++++
Triton X-1001%4°C1-2 hours++
Digitonin0.5-1%4°C4-6 hours+++
  • Purification Strategy: A two-step purification approach is most effective, beginning with immobilized metal affinity chromatography (IMAC) using a His-tag, followed by size exclusion chromatography to separate protein-detergent complexes from aggregates and free detergent.

  • Buffer Optimization: Maintaining stability during purification requires buffers containing 150-300 mM NaCl, 20 mM Tris-HCl (pH 7.5-8.0), 5-10% glycerol, and detergent at approximately 2× CMC .

How can I optimize the expression of soluble kdpC protein using DoE approaches?

Design of Experiments (DoE) methodologies offer significant advantages over traditional one-factor-at-a-time approaches for optimizing recombinant kdpC expression. A response surface methodology can identify optimal conditions through a carefully designed factorial experiment:

  • Key Parameters to Optimize:

    • Induction OD600 (typically test range: 0.4-1.0)

    • Inducer concentration (IPTG: 0.1-1.0 mM)

    • Post-induction temperature (16-30°C)

    • Duration of expression (4-24 hours)

    • Media composition (particularly potassium concentration)

  • DoE Implementation:

    • Design a central composite design with these factors

    • Include at least 3 center points to assess experimental variability

    • Analyze results using statistical software to generate response surfaces

  • Optimization Results: Based on previous studies with membrane proteins, the following conditions often yield optimal results for membrane proteins like kdpC:

ParameterOptimal RangeEffect on Soluble Yield
Induction OD6000.6-0.8Higher density improves yield until metabolic burden becomes limiting
IPTG concentration0.2-0.5 mMLower concentrations reduce inclusion body formation
Temperature18-22°CLower temperatures improve folding but extend expression time
Duration16-20 hoursLonger times increase yield but may affect protein stability
MediaTB with 0.5-2% glucoseComplex media improve yield; glucose prevents leaky expression

This approach typically increases soluble protein yield by 40-70% compared to non-optimized conditions .

What are the most effective methods for assessing the functional activity of recombinant kdpC?

Since kdpC functions as part of the KdpFABC complex, functional assessment requires analyzing its ability to assemble properly with other complex components and contribute to potassium transport. The following methodological approaches are recommended:

  • Co-expression and Co-purification Assays:

    • Co-express kdpC with other KdpFABC components

    • Perform pull-down assays to confirm complex formation

    • Analyze complex integrity using native PAGE or size exclusion chromatography

  • Reconstitution into Proteoliposomes:

    • Reconstitute purified kdpC (ideally with complete KdpFABC complex) into liposomes

    • Monitor potassium transport using fluorescent potassium indicators (e.g., PBFI)

    • Calculate transport rates under varying conditions

  • ATPase Activity Assays:

    • While kdpC itself doesn't have ATPase activity, its proper assembly with kdpB affects the ATPase activity of the complex

    • Monitor ATP hydrolysis rates of the reconstituted complex using malachite green phosphate assays

    • Compare wild-type with mutant versions to assess the contribution of kdpC to complex function

  • Thermostability Assays:

    • Use differential scanning fluorimetry to assess protein stability

    • Compare stability profiles in the presence of various ligands and other complex components

    • Correlate stability with functional activity

How can I investigate the role of kdpC in S. dysenteriae virulence and pathogenesis?

Investigating the relationship between kdpC and S. dysenteriae virulence requires sophisticated approaches that link potassium homeostasis to pathogenesis mechanisms:

  • Gene Knockout/Complementation Studies:

    • Generate a kdpC deletion mutant in S. dysenteriae serotype 1

    • Complement with wild-type and mutant versions of kdpC

    • Assess bacterial survival under potassium-limited conditions mimicking host environments

    • Evaluate virulence using in vitro invasion assays with epithelial cell lines

  • Host-Pathogen Interaction Models:

    • Compare wild-type and kdpC-deficient strains in cellular infection models

    • Monitor bacterial persistence and replication within macrophages

    • Assess contribution to resistance against antimicrobial peptides that may disrupt membrane potential

  • Transcriptomic Analysis:

    • Perform RNA-seq of wild-type vs. kdpC mutants under various potassium concentrations

    • Identify gene expression networks connecting potassium homeostasis to virulence factor expression

    • The following patterns have been observed in related studies:

ConditionEffect on Virulence Gene ExpressionEffect on Stress Response Genes
K+ limitation, wild-typeModerate upregulation of Shiga toxin genesStrong induction of stress response
K+ limitation, ΔkdpCDysregulated virulence gene expressionHeightened stress response
K+ sufficiencyBaseline virulence expressionMinimal stress response
  • In Vivo Models:

    • Compare wild-type and kdpC-deficient strains in appropriate animal models

    • Measure bacterial load, tissue damage, and inflammatory responses

    • Correlate findings with in vitro observations

What strategies can address the challenges of protein misfolding and inclusion body formation with recombinant kdpC?

As a membrane protein, kdpC presents significant challenges related to proper folding and inclusion body formation. Advanced strategies to address these issues include:

  • Fusion Tags for Enhanced Solubility:

    • SUMO tag: Enhances solubility while maintaining native N-terminus after cleavage

    • MBP tag: Significantly improves solubility though adds considerable size

    • Thioredoxin: Facilitates proper disulfide bond formation

  • Inclusion Body Recovery and Refolding:
    When inclusion bodies are unavoidable, optimize refolding with:

    • Mild solubilization using 2M urea rather than 8M to preserve secondary structure

    • Step-wise dialysis with decreasing denaturant concentrations

    • Addition of detergents and lipids during refolding to mimic membrane environment

    • Cyclodextrin-assisted refolding for gradual detergent removal

  • Chaperone Co-expression Systems:

    Chaperone SystemTarget IssueRecommended VectorInduction Strategy
    GroEL/GroESGeneral foldingpGro7L-arabinose (0.5-2 mg/ml)
    DnaK/DnaJ/GrpEPreventing aggregationpKJE7L-arabinose (0.5-2 mg/ml)
    Trigger factorCo-translational foldingpTf16L-arabinose (0.5-2 mg/ml)
    Combined systemsMultiple folding issuespG-KJE8Tetracycline + L-arabinose
  • Cell-Free Expression Systems with Nanodiscs:

    • Perform cell-free protein synthesis in the presence of pre-formed nanodiscs

    • Direct integration into lipid environment during translation

    • Optimize lipid composition to match native bacterial membrane characteristics

How can structural studies of kdpC inform the development of novel antimicrobial strategies?

Structural characterization of kdpC provides valuable insights for antimicrobial development targeting potassium homeostasis in S. dysenteriae:

  • High-Resolution Structural Analysis:

    • Optimize protein for crystallization or cryo-EM studies

    • Focus on co-structures with other KdpFABC components

    • Identify conformational changes during transport cycle

    • Map critical interfaces between subunits

  • Structure-Guided Drug Design:

    • Identify druggable pockets at interfaces between kdpC and other complex components

    • Perform in silico screening of compound libraries targeting these interfaces

    • Design peptide inhibitors mimicking critical interaction motifs

    • Validated targets include:

    InterfaceFunctionDruggability ScorePotential Inhibitor Classes
    kdpC-kdpBEnergy couplingHighSmall molecules, peptides
    kdpC-membraneAnchoringModerateAmphipathic compounds
    kdpC-kdpAComplex stabilityModeratePeptide mimetics
  • Rational Mutagenesis for Functional Validation:

    • Identify conserved residues in kdpC through sequence analysis

    • Generate point mutations in key structural and functional regions

    • Assess effects on complex assembly and function

    • Correlate structural changes with functional outcomes

  • Comparative Analysis with Human Proteins:

    • Assess structural similarities with human P-type ATPases

    • Identify unique features of bacterial kdpC to minimize off-target effects

    • Focus on species-specific regions for selective targeting

What are the best methods for analyzing protein-protein interactions involving kdpC within the KdpFABC complex?

Understanding the interactions between kdpC and other components of the KdpFABC complex requires sophisticated analytical approaches:

  • Cross-linking Mass Spectrometry (XL-MS):

    • Use chemical cross-linkers of various arm lengths to capture transient interactions

    • Analyze cross-linked peptides using high-resolution mass spectrometry

    • Map interaction sites based on identified cross-links

    • Create distance restraints for structural modeling

  • Surface Plasmon Resonance (SPR) and Bio-Layer Interferometry (BLI):

    • Quantitatively measure binding kinetics between kdpC and other subunits

    • Determine affinity constants (KD) under varying conditions

    • Assess the impact of mutations on binding properties

    • Typical binding parameters observed for membrane protein complexes:

    InteractionAssociation Rate (ka)Dissociation Rate (kd)Affinity (KD)
    kdpC-kdpB10³-10⁴ M⁻¹s⁻¹10⁻³-10⁻⁴ s⁻¹10⁻⁷-10⁻⁸ M
    kdpC-kdpA10²-10³ M⁻¹s⁻¹10⁻²-10⁻³ s⁻¹10⁻⁵-10⁻⁶ M
    kdpC-membraneContext-dependentContext-dependentContext-dependent
  • Förster Resonance Energy Transfer (FRET):

    • Label kdpC and interaction partners with appropriate fluorophore pairs

    • Monitor energy transfer as a measure of proximity

    • Perform experiments in reconstituted systems to maintain native-like environment

    • Use time-resolved measurements to capture dynamic interactions

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare deuterium uptake patterns of isolated kdpC versus complex-bound kdpC

    • Identify regions with altered solvent accessibility upon complex formation

    • Map protected regions to interaction interfaces

    • Correlate findings with other structural data

How can I address data inconsistencies when comparing recombinant kdpC with native protein function?

Resolving discrepancies between recombinant and native kdpC function requires systematic troubleshooting and methodological refinements:

  • Sources of Potential Discrepancies:

    • Post-translational modifications present in native but not recombinant protein

    • Structural differences due to expression system limitations

    • Impact of purification methods on protein conformation

    • Influence of detergents versus native membrane environment

  • Comparison Methodology:

    • Isolate native KdpFABC complex from S. dysenteriae under potassium-limited conditions

    • Purify using techniques that maintain complex integrity

    • Compare biochemical properties with recombinant versions

    • Use multiple functional assays to build a comprehensive comparison profile

  • Validation Approaches:

    ParameterAnalytical MethodExpected Correlation
    Secondary structureCircular dichroismHigh correlation expected
    Tertiary structureLimited proteolysis patternsModerate correlation
    Complex assemblyNative PAGE, SEC-MALSVariable depending on expression system
    ATPase activityCoupled enzyme assaysOften lower in recombinant systems
    Transport functionPotassium flux assaysMost sensitive to preparation differences
  • Reconciliation Strategies:

    • Optimize expression conditions based on comparative data

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) to better mimic native environment

    • Implement functional complementation assays in kdpC-deficient bacteria

    • Use site-directed mutagenesis to test hypotheses about structural discrepancies

What computational approaches can predict the impact of mutations in kdpC on S. dysenteriae fitness?

Advanced computational methods provide valuable insights into how mutations in kdpC affect bacterial fitness and potassium homeostasis:

How does antimicrobial resistance in S. dysenteriae affect kdpC expression and function?

The relationship between antimicrobial resistance and kdpC function represents an important emerging research area:

  • Transcriptional Regulation Under Antibiotic Stress:

    • Analyze transcriptome data from resistant strains under various conditions

    • Monitor kdpC expression in response to different antibiotic classes

    • Compare expression patterns between susceptible and resistant isolates

    • Preliminary findings indicate:

    Antibiotic ClassEffect on kdpC Expression in Resistant StrainsProposed Mechanism
    FluoroquinolonesUpregulation (2-4 fold)Membrane stress response
    Beta-lactamsVariable responseCell wall integrity pathways
    AminoglycosidesSignificant upregulation (4-8 fold)PMF and electrolyte balance disruption
    TetracyclinesMinimal effectLimited membrane disruption
  • Functional Adaptations in Resistant Strains:

    • Compare kdpC sequence and structure between susceptible and resistant isolates

    • Identify mutations that may alter function or regulation

    • Assess the contribution of potassium homeostasis to resistance mechanisms

    • Investigate cross-talk between resistance determinants and kdpC regulation

  • Therapeutic Implications:

    • Explore combination approaches targeting both resistance mechanisms and potassium homeostasis

    • Evaluate kdpC inhibitors as resistance-modifying agents

    • Assess potential for sensitizing resistant strains by manipulating potassium availability

    • Develop screening systems for identifying compounds that target resistant strains through kdpC-dependent mechanisms

What novel experimental approaches are emerging for studying kdpC in its native membrane environment?

Cutting-edge technologies are transforming our ability to study membrane proteins like kdpC in more native-like conditions:

  • Advanced Membrane Mimetics:

    • Native nanodiscs assembled from bacterial membrane extracts

    • Polymer-encapsulated native membranes (PENMs)

    • Cell-derived giant plasma membrane vesicles (GPMVs)

    • Comparison of system advantages:

    SystemLipid CompositionProtein ContextAnalytical CompatibilityScalability
    NanodiscsDefined or nativeIsolatedExcellentGood
    SMALPsNativePartial nativeVery goodModerate
    PENMsNativeNear-nativeGoodLimited
    GPMVsNativeNativeLimitedPoor
  • In-cell Structural Biology:

    • Cryo-electron tomography of bacterial cells expressing tagged kdpC

    • In-cell NMR for detecting conformational changes

    • Mass photometry for analyzing complex formation in cellular extracts

    • Single-molecule tracking to monitor dynamics and localization

  • Microfluidic Approaches:

    • Droplet-based single-cell analysis of kdpC function

    • Gradient generators for studying response to varying potassium levels

    • Organ-on-chip models for host-pathogen interaction studies

    • High-throughput functional screening in membrane protein arrays

  • Genetic Code Expansion for Site-Specific Labeling:

    • Incorporate unnatural amino acids at specific positions in kdpC

    • Enable precise attachment of fluorophores, cross-linkers, or affinity tags

    • Study dynamics and interactions with minimal perturbation

    • Capture transient states through photo-crosslinking

How can high-throughput approaches accelerate functional studies of kdpC variants?

Modern high-throughput methods enable comprehensive analysis of kdpC variants to map structure-function relationships:

  • Deep Mutational Scanning:

    • Generate libraries of thousands of kdpC variants

    • Link variants to unique barcodes for next-generation sequencing readout

    • Select for function using growth under potassium limitation

    • Construct comprehensive maps of mutational effects:

    RegionTolerance to MutationCritical ResiduesFunctional Impact
    Transmembrane domainsLowGlycines, charged residuesMembrane insertion, complex assembly
    Cytoplasmic loopsModerateConserved motifsInteraction with kdpB
    Periplasmic regionsVariableSpecies-specificPotential species adaptation
    C-terminusLowHydrophobic clusterComplex stability
  • Microfluidic Encapsulation and Screening:

    • Encapsulate single bacteria expressing different kdpC variants

    • Include fluorescent reporters for potassium transport or growth

    • Sort based on functional readouts

    • Recover and sequence beneficial variants

  • CRISPR-Based Screening Platforms:

    • Use CRISPR interference or activation to modulate kdpC expression

    • Perform genome-wide screens to identify genetic interactions

    • Map synthetic lethal and synthetic rescue interactions

    • Discover novel pathways connected to potassium homeostasis

  • Parallelized Structural Analysis:

    • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) on variant libraries

    • Implement thermal proteome profiling to assess stability across variants

    • Use limited proteolysis coupled with mass spectrometry for conformational analysis

    • Correlate structural perturbations with functional outcomes

How can insights from recombinant kdpC studies inform vaccine development against S. dysenteriae?

While potassium transport proteins are not traditional vaccine targets, research on recombinant kdpC can inform novel vaccine strategies:

  • Epitope Mapping and Accessibility:

    • Identify surface-exposed regions of kdpC accessible to antibodies

    • Characterize immunogenic epitopes through computational prediction and experimental validation

    • Assess conservation across Shigella strains and related enterobacteria

    • Evaluate cross-reactivity potential:

    RegionConservationAccessibilityImmunogenicityCross-Reactivity Risk
    Periplasmic loopsModerateHighModerateLow with human proteins
    Cytoplasmic domainsHighLowVariableModerate with bacterial ATPases
    Transmembrane regionsVery highVery lowLowHigh across species
  • Subunit Vaccine Design:

    • Engineer soluble fragments containing immunogenic epitopes

    • Fuse with carrier proteins to enhance immunogenicity

    • Optimize formulation and adjuvant selection

    • Evaluate protective efficacy in animal models

  • Attenuated Vaccine Strains:

    • Create S. dysenteriae strains with modified kdpC to attenuate virulence

    • Engineer strains with altered potassium dependence for controlled growth

    • Assess stability, safety, and immunogenicity profiles

    • Compare protection against wildtype challenge

  • Correlates of Protection:

    • Develop assays to measure functional antibody responses

    • Identify biomarkers correlating with protection

    • Establish threshold levels required for immunity

    • Evaluate durability of protective responses

What are the methodological considerations for using recombinant kdpC in diagnostic applications?

Recombinant kdpC protein has potential applications in developing improved diagnostics for S. dysenteriae:

  • Antibody Development for Detection:

    • Generate monoclonal antibodies against purified recombinant kdpC

    • Screen for specificity across Shigella species and serotypes

    • Optimize antibody pairs for sandwich ELISA development

    • Comparison of antibody generation approaches:

    MethodSpecificitySensitivityDevelopment TimeCost
    Hybridoma technologyVery highHigh3-6 monthsHigh
    Phage displayHighModerate to high2-4 monthsModerate
    Recombinant antibody engineeringCustomizableCustomizable1-3 monthsModerate to high
    Nanobody developmentVery highVery high2-4 monthsModerate
  • Lateral Flow Assay Development:

    • Optimize protein immobilization on membranes

    • Determine detection limits and specificity

    • Validate with clinical isolates and samples

    • Assess stability under field conditions

  • PCR Target Validation:

    • Identify signature sequences within the kdpC gene

    • Design and validate primers for species-specific detection

    • Develop multiplexed assays targeting multiple virulence factors

    • Compare sensitivity and specificity with traditional targets

  • Biosensor Applications:

    • Immobilize recombinant kdpC or anti-kdpC antibodies on biosensor surfaces

    • Optimize detection methods (electrochemical, optical, etc.)

    • Validate detection limits, specificity, and reproducibility

    • Evaluate performance in complex biological matrices

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.