Recombinant Shigella dysenteriae serotype 1 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to Shigella dysenteriae and ArnE Protein

Shigella dysenteriae serotype 1 (SD1) is a Gram-negative, non-spore-forming, non-motile, facultative aerobic, rod-shaped bacterium first discovered in 1897. This pathogen causes the most severe form of epidemic bacillary dysentery, particularly affecting populations in Africa and South Asia . Among the four Shigella species (S. dysenteriae, S. flexneri, S. boydii, and S. sonnei), S. dysenteriae serotype 1 is associated with the most significant morbidity and mortality worldwide . The bacterium specifically targets primates, including humans and gorillas, but does not typically cause disease in other mammals .

The ArnE protein in S. dysenteriae functions as a subunit of the undecaprenyl phosphate-α-L-Ara4N flippase, a membrane transport system that plays a critical role in modifying bacterial lipopolysaccharide (LPS) . This modification process is essential for bacterial resistance to polymyxin and other cationic antimicrobial peptides, representing a significant virulence mechanism . The recombinant form of this protein has garnered substantial research interest for its potential applications in vaccine development and therapeutic targeting.

Comparative Analysis with Related Proteins

ArnE functions together with ArnF to form a complete flippase complex. The ArnE/ArnF complex in bacteria serves as an undecaprenyl phosphate-α-L-Ara4N exporter, fulfilling a role analogous to but distinct from eukaryotic lipid flippases . Table 1 illustrates the comparison between bacterial ArnE and related bacterial flippase proteins.

Table 1: Comparison of ArnE with Related Bacterial Flippase Proteins

ProteinOrganismLength (aa)FunctionResistance Provided
ArnEShigella dysenteriae serotype 1111Undecaprenyl phosphate-α-L-Ara4N flippase subunitPolymyxin, CAMPs
ArnEShigella sonnei111Undecaprenyl phosphate-α-L-Ara4N flippase subunitPolymyxin, CAMPs
ArnEEscherichia coli O139:H28111Undecaprenyl phosphate-α-L-Ara4N flippase subunitPolymyxin B, CAMPs
ArnFEscherichia coli K-12128Undecaprenyl phosphate-α-L-Ara4N flippase subunitPolymyxin B, CAMPs

LPS Modification Pathway

The ArnE protein plays a crucial role in the lipid A modification pathway of Shigella dysenteriae. This pathway involves the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A phosphates, a modification that reduces the net negative charge of the bacterial outer membrane . Figure 1 illustrates the sequential steps in this pathway:

  1. Conversion of UDP-glucose to UDP-glucuronic acid

  2. Oxidative decarboxylation to UDP-4-ketopentose by ArnA

  3. Transamination by ArnB to generate UDP-β-L-Ara4N

  4. N-formylation by the N-terminal domain of ArnA

  5. Transfer of N-formylated L-Ara4N to undecaprenyl phosphate by ArnC

  6. Deformylation by ArnD

  7. Transport of undecaprenyl phosphate-L-Ara4N across the inner membrane by ArnE/ArnF flippase

  8. Transfer of L-Ara4N to lipid A by ArnT

This pathway ultimately results in reduced susceptibility to antimicrobial peptides, including polymyxins, which are often considered last-resort antibiotics for multidrug-resistant Gram-negative infections .

Mechanism of Flippase Activity

The ArnE protein, together with its partner ArnF, forms a membrane-spanning complex that facilitates the translocation of undecaprenyl phosphate-α-L-Ara4N from the cytoplasmic to the periplasmic side of the inner membrane . This transport mechanism is critical for the subsequent modification of lipid A by ArnT.

Unlike eukaryotic P4-ATPase flippases that require ATP hydrolysis for lipid translocation, the ArnE/ArnF complex appears to function through an ATP-independent mechanism . The exact molecular mechanism of this transport remains partially understood, but structural analyses suggest a pathway through which the headgroup of the lipid substrate can pass while the hydrophobic tail remains in the membrane environment .

Expression Systems and Purification

Recombinant Shigella dysenteriae serotype 1 ArnE protein is typically produced using bacterial expression systems, particularly E. coli, though alternative expression platforms including yeast, baculovirus, and mammalian cell systems are also employed for specific applications . The protein is commonly expressed with an N-terminal histidine tag to facilitate purification via metal affinity chromatography .

Table 2: Expression Systems for Recombinant ArnE Production

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, fast growth, economicalPotential improper folding of membrane proteinsStructural studies, antibody production
YeastPost-translational modifications, proper foldingLonger production timeFunctional studies
BaculovirusComplex protein expression, post-translational modificationsTechnical complexity, higher costVaccine development
Mammalian CellNative-like folding and modificationsHighest cost, lower yieldDrug screening, functional assays

The purified recombinant protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability. For long-term storage, addition of glycerol (5-50% final concentration) and storage at -20°C/-80°C is recommended .

Quality Assessment and Characterization

The purity of recombinant ArnE protein is typically assessed using SDS-PAGE, with commercial preparations generally exceeding 90% purity . Additional characterization techniques may include:

  1. Western blotting for protein identification and antigenicity assessment

  2. Circular dichroism spectroscopy for secondary structure analysis

  3. Mass spectrometry for precise molecular weight determination

  4. Functional assays to verify lipid flippase activity

Vaccine Development

Recombinant Shigella dysenteriae ArnE protein has significant potential for vaccine development due to its role in bacterial virulence and outer membrane modification . The protein's involvement in antimicrobial peptide resistance makes it an attractive target for vaccine strategies aimed at neutralizing this defense mechanism.

The proteome analysis of Shigella dysenteriae serotype 1 has identified several outer membrane proteins as potential vaccine candidates, with proteins involved in virulence mechanisms being particularly promising . The T3SS (Type III Secretion System) effectors, including those that might interact with membrane-modifying proteins like ArnE, have shown immunogenic properties that could be exploited for vaccine development .

Antimicrobial Drug Discovery

Understanding the structure and function of ArnE provides valuable insights for developing novel antimicrobial strategies. By targeting the ArnE/ArnF flippase complex, researchers aim to disrupt the lipid A modification pathway, thereby rendering bacteria more susceptible to existing antimicrobials, particularly polymyxins and other cationic antimicrobial peptides .

Table 3: Potential Therapeutic Applications Targeting ArnE

ApproachMechanismPotential AdvantageDevelopment Stage
Flippase inhibitorsDirect inhibition of ArnE/ArnF activityRestoration of polymyxin sensitivityPreclinical research
Anti-ArnE antibodiesNeutralization of surface-exposed epitopesComplement-mediated bacterial killingEarly research
Combination therapySynergistic action with existing antibioticsLower effective antibiotic dosesConceptual
CRISPR-Cas targetingGenetic disruption of arnE expressionPermanent susceptibility to CAMPsExperimental

Comparative Analysis with ArnE from Other Species

The ArnE protein structure and function are well-conserved across various Gram-negative bacterial species, reflecting its fundamental role in antimicrobial resistance. Recombinant ArnE proteins from different Shigella species (including S. sonnei) and related enterobacteria like Escherichia coli and Salmonella exhibit high sequence homology and functional similarity .

Table 4: Comparison of ArnE Protein Characteristics Across Species

SpeciesProtein LengthSequence Identity to S. dysenteriae ArnENotable Differences
Shigella dysenteriae111 aa100%Reference sequence
Shigella sonnei111 aa>95%Minor variations in non-functional regions
Escherichia coli111 aa>90%Conserved functional domains
Salmonella paratyphiPartial~85%Some variation in transmembrane domains

This high degree of conservation makes the recombinant S. dysenteriae ArnE protein a valuable model for studying antimicrobial resistance mechanisms across multiple pathogenic species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; SDY_2453.1; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLNLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein functions by translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic side to the periplasmic side.
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ArnE in Shigella dysenteriae serotype 1?

ArnE functions as a subunit of a proposed flippase heterodimer (ArnE/F) in the 4-aminoarabinose modification pathway. It is involved in the translocation of bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N) from the cytoplasm to the periplasmic space of the bacterial cell. This process is critical for the addition of 4-aminoarabinose (Ara4N) to lipid A, a component of lipopolysaccharide (LPS) in the outer membrane of Gram-negative bacteria like S. dysenteriae . The modification is particularly important as it contributes to antimicrobial peptide resistance by reducing the negative charge of the bacterial outer membrane, thereby decreasing the binding affinity of cationic antimicrobial peptides.

How is the arn operon organized in S. dysenteriae compared to other Gram-negative bacteria?

The arn operon (also known as pmr operon in some species) typically contains genes encoding enzymes necessary for the synthesis and transfer of 4-aminoarabinose to lipid A. In S. dysenteriae, similar to other Enterobacteriaceae, the operon includes arnB (pmrH), arnC (pmrF), arnA (pmrI), arnD (pmrJ), arnT (pmrK), arnE (pmrM), and arnF (pmrL). While the general organization is conserved across species, there may be subtle differences in promoter regions and regulatory elements. Research approaches to studying this organization typically involve comparative genomics, focusing on sequence alignments and promoter analysis techniques. PCR-based methods using specific primers for the arnE gene can be employed for initial identification and characterization, similar to the approaches used for virulence gene detection in Shigella species .

What methods are effective for detecting arnE expression in S. dysenteriae?

Several methodological approaches can be employed to detect arnE expression:

  • Quantitative RT-PCR: Primers specific to the arnE gene can be designed for quantitative measurement of transcript levels under different growth conditions.

  • Western Blotting: Using antibodies specific to ArnE protein can detect expression at the protein level.

  • Reporter Gene Fusions: Creating transcriptional or translational fusions between arnE and reporter genes (like lacZ or GFP) can help monitor expression patterns.

  • RNA-Seq: For genome-wide expression analysis, including arnE expression in context with other genes.

  • Northern Blotting: For direct visualization of arnE transcript abundance.

The selection of specific detection methods should account for the likely membrane-associated nature of ArnE and potentially low expression levels under standard laboratory conditions. Expression studies should include appropriate controls, such as growth under conditions known to induce the arn operon (e.g., low Mg²⁺ or presence of Fe³⁺), as observed in studies examining bactoprenyl-linked substrate accumulation .

How can researchers experimentally confirm the flippase function of ArnE in S. dysenteriae?

Confirming the flippase function of ArnE requires multiple complementary approaches:

  • Gene Deletion Studies: Creating ΔarnE mutants in S. dysenteriae and assessing changes in lipid A modification profiles. This approach has been used effectively in related studies with ΔarnC and ΔarnD mutations .

  • Complementation Assays: Reintroducing the arnE gene on a plasmid to restore the wild-type phenotype in the deletion mutant.

  • Membrane Vesicle Assays: Isolating membrane vesicles from wild-type and ΔarnE strains to assess their ability to translocate BP-Ara4N across membranes in vitro.

  • Fluorescent Substrate Tracking: Using fluorescently labeled BP analogs (like 2CN-BP mentioned in the literature) to track substrate movement across membranes in the presence and absence of ArnE .

  • Mass Spectrometry Analysis: Analyzing lipid A modifications using ESI-LC-MS to detect the presence or absence of Ara4N modifications in different genetic backgrounds, similar to approaches used to detect BP-Ara4N in ΔarnD mutants .

A comprehensive experimental design would include controls such as strains with mutations in other arn operon genes and analysis under conditions known to induce or repress the arn pathway.

What is the relationship between environmental conditions and arnE expression in S. dysenteriae?

The expression of arnE, like other genes in the arn operon, is regulated by environmental conditions that typically mimic those encountered during host infection. Methodological approaches to study this relationship include:

  • Growth in Defined Media: Culturing S. dysenteriae under varying conditions (pH, Mg²⁺ concentration, Fe³⁺ levels) known to affect the PhoPQ and PmrAB two-component systems that regulate arn operon expression.

  • In vitro Induction Assays: Exposing bacteria to sublethal concentrations of antimicrobial peptides to measure arnE upregulation.

  • Reporter Gene Assays: Using arnE promoter-reporter fusions to quantify expression under different environmental conditions.

  • Transcriptome Analysis: Employing RNA-Seq to analyze global gene expression changes, including arnE, under various environmental stresses.

Research has shown that Fe³⁺ can promote the accumulation of BP-Ara4N and BP-Ara4FN (the formylated precursor), suggesting that iron availability influences the activity of the Arn pathway . This finding indicates that environmental iron levels should be carefully controlled when studying ArnE function.

What structural features of ArnE contribute to its flippase activity?

Understanding the structural features of ArnE requires:

  • Membrane Topology Prediction: Using bioinformatics tools to predict transmembrane domains and protein orientation.

  • Site-Directed Mutagenesis: Systematically mutating conserved residues to identify those critical for function.

  • Cysteine Scanning Mutagenesis: Introducing cysteine residues at different positions followed by sulfhydryl labeling to probe accessibility.

  • Protein Purification and Reconstitution: Purifying ArnE and reconstituting it in liposomes to assess activity in a defined system.

  • Structural Studies: Employing techniques like X-ray crystallography or cryo-EM for direct structural determination.

The functional relationship between ArnE and ArnF in forming a heterodimer is particularly important, as suggested by studies of the Ara4N modification pathway . The experimental approaches should include analysis of both proteins individually and as a complex.

How does ArnE contribute to antimicrobial resistance in S. dysenteriae serotype 1?

The contribution of ArnE to antimicrobial resistance can be investigated through:

  • Minimum Inhibitory Concentration (MIC) Assays: Comparing susceptibility of wild-type and ΔarnE mutants to various antimicrobial peptides and antibiotics.

  • Time-Kill Assays: Measuring bacterial survival over time when exposed to antimicrobials.

  • Membrane Permeability Assays: Using fluorescent dyes to assess changes in membrane permeability in the presence and absence of ArnE.

  • In vivo Infection Models: Testing the virulence and persistence of ΔarnE mutants in animal models.

  • Lipid A Analysis: Quantifying the degree of Ara4N modification using mass spectrometry and correlating with resistance profiles.

Antimicrobial AgentWild-type MIC (μg/mL)ΔarnE Mutant MIC (μg/mL)Fold Change
Polymyxin B8-160.5-28-16×
Colistin4-80.25-18-16×
LL-37 (human)32-644-8
Gentamicin2-42-4No change
Ciprofloxacin0.015-0.030.015-0.03No change

Note: This table represents hypothetical data based on typical patterns observed with arn pathway mutations in Gram-negative bacteria. Actual values would need to be determined experimentally for S. dysenteriae serotype 1.

What methodological approaches resolve contradictions in ArnE function across bacterial species?

Resolving contradictions in reported ArnE functions requires:

  • Standardized Experimental Conditions: Ensuring consistent growth conditions, induction methods, and analytical techniques across studies.

  • Cross-Species Complementation: Testing whether ArnE from one species can complement ΔarnE mutations in another species.

  • Domain Swapping Experiments: Creating chimeric proteins with domains from different species to identify regions responsible for functional differences.

  • Systems Biology Approaches: Integrating transcriptomics, proteomics, and metabolomics data to understand species-specific contexts.

  • Evolutionary Analysis: Conducting phylogenetic studies to trace the evolution of ArnE function across bacterial lineages.

When comparing results across studies, it's crucial to consider differences in experimental methods, such as the approach used to detect BP-linked substrates, which has been noted as a limitation in characterizing enzymes involved in lipid A modifications .

How can recombinant ArnE be utilized in developing cross-protective vaccines against S. dysenteriae?

The potential for recombinant ArnE in vaccine development can be explored through:

  • Epitope Mapping: Identifying immunogenic regions of ArnE that could serve as vaccine targets.

  • Recombinant Protein Expression: Optimizing expression systems for producing soluble, properly folded ArnE protein.

  • Adjuvant Formulation Studies: Testing different adjuvants to enhance immune responses to ArnE-based antigens.

  • Cross-Protection Assays: Evaluating whether immunization with ArnE provides protection against multiple Shigella species or strains.

  • Outer Membrane Vesicle (OMV) Incorporation: Examining the inclusion of ArnE in OMV-based vaccine platforms, similar to approaches used with other Shigella antigens .

This approach could be particularly valuable when combined with strategies like those described for S. flexneri OMVs engineered to carry additional antigens, which have shown promise as subunit vaccine candidates .

What controls are essential when creating and analyzing arnE knockouts in S. dysenteriae?

Critical controls for arnE knockout studies include:

  • Parent Strain Control: Always compare the knockout to the original parent strain under identical conditions.

  • Complementation Control: Reintroduce arnE on a plasmid to confirm phenotypes are due to the specific gene deletion.

  • Polar Effect Control: Ensure that deletion of arnE doesn't affect expression of downstream genes, particularly arnF, its heterodimer partner.

  • Growth Condition Controls: Test phenotypes under both inducing (low Mg²⁺, high Fe³⁺) and non-inducing conditions for the arn operon.

  • Multiple Knockout Methods: Confirm key findings using different knockout strategies (e.g., insertion mutation vs. clean deletion).

  • Cross-Complementation: Test whether arnE from other species (like E. coli) can complement the S. dysenteriae knockout.

When analyzing membrane-associated functions, it's particularly important to verify that membrane fractionation procedures are consistent between samples, as demonstrated in studies examining membrane fraction-mediated formation of modified bactoprenyl compounds .

How can researchers optimize detection of ArnE-mediated flippase activity in vitro?

Optimizing detection of ArnE flippase activity requires:

  • Substrate Preparation: Synthesizing or purifying adequate amounts of BP-Ara4N as the native substrate.

  • Fluorescent Analogs: Developing fluorescent BP analogs that can serve as alternative substrates for activity assays.

  • Reconstitution System: Establishing a liposome-based system with purified ArnE/F proteins.

  • Assay Conditions: Optimizing buffer composition, pH, temperature, and divalent cation concentrations.

  • Detection Methods: Employing sensitive analytical techniques like fluorescence spectroscopy or mass spectrometry.

Researchers have noted limitations in procuring and detecting native BP-linked substrates, which has hindered characterization of enzymes involved in lipid A modifications . Recently developed fluorescent bactoprenyl analogs offer a promising approach to overcome these limitations.

What approaches can differentiate between ArnE and ArnF contributions to the flippase complex?

Differentiating the roles of ArnE and ArnF requires:

  • Individual Gene Knockouts: Creating separate ΔarnE and ΔarnF mutants and comparing their phenotypes.

  • Site-Directed Mutagenesis: Mutating specific residues in each protein to identify functionally important regions.

  • Co-Immunoprecipitation: Assessing protein-protein interactions between ArnE and ArnF.

  • Bacterial Two-Hybrid Assays: Mapping interaction domains between the two proteins.

  • In vitro Reconstitution: Testing activity with purified individual proteins versus the complex.

  • Cross-Linking Studies: Using chemical cross-linkers to capture the ArnE/F complex in its native membrane environment.

Understanding the individual contributions of these proteins to the heterodimer is essential for fully characterizing the flippase mechanism that translocates BP-Ara4N from the cytoplasm to the periplasm .

How might high-throughput screening methodologies identify inhibitors of ArnE function?

High-throughput screening for ArnE inhibitors could employ:

  • Fluorescence-Based Assays: Using fluorescent BP analogs to detect inhibition of flippase activity.

  • Growth Inhibition Screens: Testing compound libraries for synergistic effects with antimicrobial peptides against wild-type but not ΔarnE mutants.

  • Surface Plasmon Resonance: Screening for compounds that bind directly to purified ArnE protein.

  • Computational Docking Studies: Using structural models to virtually screen for potential inhibitors.

  • Whole-Cell Reporter Assays: Developing reporter systems that indicate disruption of the Ara4N modification pathway.

Such inhibitors could potentially sensitize resistant S. dysenteriae to conventional antibiotics by preventing Ara4N modification of lipid A, thereby increasing the negative charge of the outer membrane and enhancing binding of cationic antimicrobial peptides.

What comparative genomics approaches could reveal evolutionary patterns in arnE conservation across pathogenic bacteria?

Evolutionary studies of arnE could include:

  • Phylogenetic Analysis: Constructing phylogenetic trees based on arnE sequences across diverse bacterial species.

  • Synteny Analysis: Examining conservation of gene order in the arn operon across species.

  • Selection Pressure Analysis: Calculating dN/dS ratios to identify regions under purifying or diversifying selection.

  • Horizontal Gene Transfer Assessment: Identifying potential instances of horizontal acquisition of arnE or the entire arn operon.

  • Structure-Function Correlation: Mapping conserved residues onto predicted structural models to identify functionally critical regions.

Such analyses could provide insights into the evolutionary significance of ArnE and potentially identify species-specific features that could be targeted for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.