Recombinant Shigella dysenteriae serotype 1 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Resistance

ArnF is part of the ArnEF flippase complex, which translocates 4-amino-4-deoxy-L-arabinose (Ara4N)-modified undecaprenyl phosphate (BP) across the inner membrane. This process is essential for lipid A modification, enabling bacterial evasion of cationic antimicrobial peptides (CAMPs) like polymyxins .

  • Mechanism:

    • Ara4N is synthesized via the Arn pathway (Ugd → ArnA → ArnB → ArnC → ArnD).

    • ArnF partners with ArnE to flip BP-Ara4N to the periplasm, where ArnT transfers Ara4N to lipid A .

    • Deformylation by ArnD commits Ara4N to lipid A modification, a critical step for antimicrobial resistance .

3.1. Antimicrobial Resistance Studies

Recombinant ArnF facilitates in vitro assays to:

  • Characterize lipid A modification pathways in Shigella and related pathogens .

  • Screen inhibitors targeting the ArnEF flippase to counteract polymyxin resistance .

3.2. Vaccine Development

  • ArnF is implicated in immune evasion mechanisms. Proteomic studies of Shigella dysenteriae in host environments highlight upregulated T3SS effectors (e.g., OspF, IpaC) and stress-response proteins (e.g., HdeA) during infection .

  • Multi-epitope vaccines targeting membrane proteins like ArnF are under exploration to combat antibiotic-resistant Shigella strains .

Epidemiological and Genomic Insights

  • Prevalence: Shigella dysenteriae accounts for ~5% of Shigella infections globally, with multidrug resistance escalating in low-resource settings .

  • Genomic Diversity: S. dysenteriae exhibits moderate genomic diversity (11.8 SNPs/kbp), lower than S. boydii (24.2 SNPs/kbp) but critical for adaptive evolution .

Technical Considerations for Use

  • Reconstitution: Centrifuge lyophilized protein before adding sterile water. Glycerol (5–50%) improves stability for long-term storage .

  • Activity Validation: Functional assays (e.g., flippase activity) require membrane fraction isolation and LC-MS to detect BP-Ara4N intermediates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please include your requirements in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is advisable to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of a protein is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid protein formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized protein maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please let us know, and we will prioritize development based on your specifications.
Synonyms
arnF; SDY_2454; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIATLLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWGGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasm to the periplasmic side of the inner membrane.
Database Links

KEGG: sdy:SDY_2454

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ArnF flippase subunit in Shigella dysenteriae serotype 1?

The ArnF flippase subunit in Shigella dysenteriae serotype 1 primarily functions as part of a membrane transport system that facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across cellular membranes. Similar to other flippases, ArnF likely modifies membrane composition by creating membrane asymmetry, which is essential for various cellular processes including vesicle formation and membrane trafficking. The flippase activity involves the bidirectional movement of specific lipid substrates between membrane leaflets, contributing to bacterial membrane organization and potentially pathogenicity . Experimentally, this function can be studied through membrane composition analysis before and after ArnF expression, using techniques such as mass spectrometry and fluorescent lipid analogs.

How does the structure of ArnF compare to similar flippase subunits in other enteric bacteria?

ArnF in Shigella dysenteriae serotype 1 shares structural similarities with related flippase subunits in other enteric bacteria, particularly the ArnE subunit found in Salmonella paratyphi A . Both proteins contain multiple transmembrane domains characteristic of membrane transport proteins. Key structural features include:

FeatureArnF (S. dysenteriae)ArnE (S. paratyphi A)Other Bacterial Flippases
Transmembrane domains6-8 predicted helices6-8 predicted helicesVariable (6-12)
Conserved motifsGxxxG dimerization motifGxxxG dimerization motifOften contain GxxxG
Protein sizeApproximately 200-250 aaApproximately 200-250 aa180-350 aa
Active site residuesBasic residues in cytoplasmic loopsSimilar patternVariable patterns

The structural conservation suggests functional similarity, though species-specific adaptations likely exist that could be explored through comparative structural biology approaches including X-ray crystallography or cryo-EM studies .

What experimental methods are most effective for purifying recombinant ArnF for in vitro studies?

Purification of recombinant ArnF presents significant challenges due to its hydrophobic nature as a membrane protein. The most effective experimental approach combines the following methodological steps:

  • Expression system optimization: Using E. coli C43(DE3) or BL21(DE3) strains with specialized vectors containing moderate-strength promoters and fusion tags (His6, MBP, or SUMO) to enhance solubility

  • Membrane extraction: Gentle solubilization using detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin at concentrations just above their critical micelle concentration

  • Affinity chromatography: Utilizing nickel-NTA for His-tagged constructs with gradual imidazole elution

  • Size exclusion chromatography: For final purification and buffer exchange to maintain protein stability

  • Quality control: Confirmation of protein integrity through Western blotting, functional assays, and thermal shift assays

Protein yield and activity should be verified through reconstitution in proteoliposomes and functional assays measuring flippase activity using fluorescent lipid analogs .

How can researchers design effective fractional factorial experiments to study ArnF interactions with membrane components?

When studying ArnF interactions with membrane components, researchers should implement efficient experimental designs that maximize information while minimizing resource utilization. A fractional factorial design approach is particularly valuable:

  • Identify experimental variables: Key factors include lipid composition (5-7 variables), buffer conditions (3-4 variables), temperature, pH, and presence of potential binding partners (3-4 variables)

  • Select a fractional factorial design: For the 14-15 variables identified, a 2^(15-p) design where p=8 would yield 128 experimental runs, providing a manageable experiment that still captures main effects and two-factor interactions

  • Define response variables: Measure binding affinity, conformational changes, and transport activity

  • Include resolution IV design: This ensures that main effects are not confounded with two-factor interactions

  • Analyze using sequential experimentation: Begin with screening experiments followed by targeted optimization

Table of experimental design structure:

Design TypeExperimental VariablesResolutionNumber of RunsInformation Yield
Full factorial15 variablesFull32,768Complete
2^(15-8)15 variablesIV128Main effects and some interactions
2^(15-10)15 variablesIII32Main effects only

This approach significantly improves experimental efficiency while maintaining scientific rigor in membrane interaction studies .

What are the critical considerations for developing an in vivo assay to evaluate ArnF flippase activity in Shigella dysenteriae?

Developing effective in vivo assays for ArnF flippase activity requires addressing several critical considerations:

  • Bacterial viability: Since S. dysenteriae is a biosafety level 2 pathogen associated with severe dysentery, appropriate containment measures must be maintained throughout experimentation

  • Reporter system selection: Ideal reporters should be membrane-associated and responsive to flippase activity, such as:

    • Fluorescent lipid analogs that change emission characteristics based on membrane leaflet location

    • Growth-dependent phenotypes linked to lipid translocation

    • Antibiotic susceptibility assays leveraging the role of 4-amino-4-deoxy-L-arabinose in antibiotic resistance

  • Genetic manipulation system: Development of inducible expression systems and knockout strains through CRISPR-Cas9 or homologous recombination

  • Controls: Including non-functional ArnF mutants (e.g., ATP-binding site mutations) and related flippases from model organisms

  • Phenotypic validation: Connecting observed changes to physiological outcomes through electron microscopy for membrane structure and antibiotic resistance profiling

Researchers should validate assays initially in model organisms before transferring to S. dysenteriae to minimize biosafety concerns while optimizing experimental conditions .

How can researchers overcome the challenges in distinguishing ArnF activity from other membrane-modifying proteins in complex bacterial systems?

Distinguishing ArnF-specific activity in complex bacterial systems requires sophisticated experimental approaches:

  • Genetic isolation strategies:

    • Create clean gene deletion strains using scarless genome editing techniques

    • Implement complementation studies with wild-type and mutant ArnF variants

    • Develop conditional expression systems using tetracycline-responsive promoters

  • Biochemical discrimination methods:

    • Use substrate specificity assays with fluorescently-labeled 4-amino-4-deoxy-L-arabinose derivatives

    • Employ antibody-based detection of specific lipid modifications

    • Implement membrane fractionation coupled with mass spectrometry to track specific lipid species

  • Real-time monitoring systems:

    • Develop FRET-based sensors that detect conformational changes during transport

    • Implement super-resolution microscopy to track membrane domain organization

    • Use microfluidic systems to measure dynamic membrane properties

  • Computational prediction and validation:

    • Apply molecular dynamics simulations to predict ArnF-specific membrane changes

    • Use machine learning algorithms to identify ArnF activity signatures in complex datasets

    • Develop bioinformatic pipelines to distinguish related flippase activities

These approaches collectively provide multiple lines of evidence that can separate ArnF-specific contributions from background membrane activities .

What are the current hypotheses regarding the role of ArnF in antimicrobial resistance mechanisms of Shigella dysenteriae serotype 1?

Current research suggests several interrelated hypotheses regarding ArnF's role in antimicrobial resistance:

  • Modification of lipopolysaccharide (LPS) structure: ArnF likely facilitates the translocation of 4-amino-4-deoxy-L-arabinose to the outer membrane, where it can modify lipid A. This modification reduces the net negative charge of the bacterial surface, decreasing binding affinity for cationic antimicrobial peptides and polymyxins.

  • Membrane permeability regulation: By altering membrane asymmetry, ArnF may contribute to decreased permeability for hydrophobic antibiotics, creating a physical barrier to antibiotic entry.

  • Stress response integration: ArnF activity appears to be upregulated during specific environmental stresses, potentially linking membrane remodeling to broader stress response networks that promote survival during antibiotic exposure.

  • Biofilm formation contribution: Modified membrane characteristics may enhance cell-cell interactions and surface attachment, promoting biofilm formation which provides inherent antibiotic resistance.

These hypotheses are supported by observations in related bacterial species, though direct experimental evidence specific to S. dysenteriae serotype 1 remains incomplete. Researchers are employing transcriptomic analyses, antibiotic susceptibility profiling, and membrane composition studies to further elucidate these mechanisms .

How can researchers effectively analyze data inconsistencies when comparing in vitro and in vivo results of ArnF functional studies?

Analyzing data inconsistencies between in vitro and in vivo ArnF studies requires a systematic approach:

  • Identify inconsistency patterns:

    • Catalog specific discrepancies in activity levels, substrate specificity, and kinetic parameters

    • Determine whether inconsistencies follow predictable patterns or appear random

    • Analyze whether inconsistencies correlate with specific experimental conditions

  • Apply statistical reconciliation methods:

    • Implement Bland-Altman plots to visualize systematic differences

    • Use mixed-effects models to account for within-study and between-study variability

    • Apply Bayesian approaches to integrate prior knowledge with experimental data

  • Consider biological explanations:

    • Evaluate the impact of the membrane environment (lipid composition, curvature, pressure)

    • Assess the presence/absence of interacting proteins and regulatory molecules

    • Investigate post-translational modifications that may occur in vivo but not in vitro

  • Develop bridging experiments:

    • Design reconstitution studies with increasing complexity to bridge the gap between purified systems and cellular environments

    • Implement membrane mimetics that better represent native environments

    • Develop cell-free expression systems that maintain physiological regulation

This systematic approach transforms apparent inconsistencies into valuable insights about context-dependent protein function and experimental limitations .

What computational approaches are most effective for predicting substrate specificity and transport efficiency of ArnF compared to other flippase families?

Computational prediction of ArnF substrate specificity and transport efficiency requires integrating multiple modeling approaches:

  • Structural prediction and analysis:

    • Homology modeling based on related flippases with known structures

    • Molecular dynamics simulations to identify substrate binding pockets and transport pathways

    • Elastic network models to predict conformational changes during transport cycles

  • Machine learning applications:

    • Support vector machines trained on known flippase-substrate pairs

    • Deep learning approaches incorporating structural and sequence features

    • Feature extraction from evolutionary sequence analysis

  • Quantitative structure-activity relationship (QSAR) models:

    • Development of descriptors specific to lipid substrates

    • Integration of physicochemical properties with structural features

    • Validation against experimental datasets from related flippases

  • Systems biology integration:

    • Flux balance analysis incorporating ArnF activity

    • Network modeling of membrane lipid homeostasis

    • Sensitivity analysis to identify rate-limiting steps in transport pathways

The most successful computational approaches typically combine these methods in a hierarchical or ensemble fashion, with iterative refinement based on experimental validation. Current accuracy levels for substrate specificity prediction range from 70-85%, with transport efficiency predictions showing slightly lower accuracy (60-75%) .

What strategies can overcome expression and solubility issues when producing recombinant ArnF for structural studies?

Membrane proteins like ArnF present significant expression and solubility challenges that can be addressed through these methodological approaches:

  • Expression system optimization:

    • Test multiple expression hosts (E. coli, Pichia pastoris, insect cells, mammalian cells)

    • Evaluate specialized E. coli strains (C41/C43(DE3), Lemo21(DE3), SHuffle)

    • Optimize codon usage for the expression host

    • Implement chemical chaperone supplementation (glycerol, betaine, sucrose)

  • Construct design strategies:

    • Create fusion proteins with highly soluble partners (MBP, SUMO, Mistic, GFP)

    • Test truncation constructs to identify stable domains

    • Implement consensus-based sequence optimization

    • Introduce stabilizing mutations identified through evolutionary analysis

  • Induction and growth conditions:

    • Use lower temperatures (16-20°C) for expression

    • Test varied induction strengths (0.01-0.5 mM IPTG or auto-induction)

    • Evaluate different media formulations and growth phases for induction

    • Implement osmotic and heat shock pre-treatments

  • Extraction and purification approaches:

    • Screen detergent panels systematically (maltoside series, cholate derivatives, neopentyl glycols)

    • Implement native nanodiscs or SMALPs for detergent-free extraction

    • Use bicelles or amphipols for improved stability

    • Implement on-column detergent exchange protocols

These approaches should be implemented systematically, with careful documentation of outcomes to identify optimal conditions for structural studies .

How can researchers differentiate between specific ArnF activity and nonspecific membrane perturbations in experimental systems?

Distinguishing specific ArnF flippase activity from nonspecific membrane effects requires multiple complementary approaches:

  • Specific inhibitor studies:

    • Develop and validate ArnF-specific inhibitors through structure-activity relationship studies

    • Implement competitive and non-competitive inhibition analyses

    • Use inactive mutants as negative controls (e.g., ATP-binding site mutants)

  • Substrate specificity profiling:

    • Compare transport rates of the natural substrate versus structural analogs

    • Implement competition assays between labeled and unlabeled substrates

    • Develop substrate analogs with systematically modified chemical groups

  • Biophysical differentiation techniques:

    • Measure membrane fluidity changes using fluorescence anisotropy

    • Track membrane potential with voltage-sensitive dyes

    • Implement quartz crystal microbalance with dissipation to measure mechanical properties

  • Synthetic biology approaches:

    • Develop orthogonal flippase-substrate pairs through protein engineering

    • Create synthetic genetic circuits that respond only to specific flippase activity

    • Implement compartmentalized directed evolution to enhance specificity

The gold standard approach combines multiple lines of evidence, particularly comparing wild-type ArnF with point mutants that retain structural integrity but lack catalytic activity .

What are the most reliable quality control metrics for ensuring functional integrity of purified recombinant ArnF preparations?

Ensuring functional integrity of purified ArnF requires a comprehensive quality control framework:

Quality Control ParameterMethodologyAcceptance CriteriaPurpose
PuritySDS-PAGE, SEC-MALS>95% homogeneity, monodisperse peakVerify isolation from contaminants
IdentityMass spectrometry, Western blotMatching predicted mass, immunoreactivityConfirm protein identity
Secondary structureCircular dichroismα-helical content >60%Verify proper folding
Thermal stabilityDifferential scanning fluorimetryTm >40°C, cooperative unfoldingAssess structural integrity
Detergent incorporationDynamic light scatteringConsistent hydrodynamic radiusVerify proper micelle formation
Substrate bindingMicroscale thermophoresis, ITCKD in μM range, stoichiometric bindingConfirm ligand interaction
ATPase activityCoupled enzyme assay, Pi releaseSpecific activity >0.5 μmol/min/mgVerify catalytic function
Lipid translocationFluorescent lipid assaysTransport rate >10% above backgroundConfirm flippase activity
Long-term stabilityActivity retention at 4°C>80% activity after 7 daysAssess storage viability

Researchers should establish these metrics during initial characterization and monitor them routinely for batch-to-batch consistency. This multi-parameter approach provides confidence in the functional integrity of purified ArnF preparations for downstream applications .

How might targeting ArnF function provide novel approaches for antimicrobial development against Shigella dysenteriae?

Targeting ArnF function represents a promising antimicrobial strategy against Shigella dysenteriae through several mechanistic approaches:

  • Direct inhibition strategies:

    • Develop small molecule inhibitors targeting the ArnF ATP-binding site

    • Create lipid-mimetic competitive inhibitors that block substrate binding

    • Design allosteric modulators that prevent conformational changes required for transport

    • Implement peptide-based inhibitors targeting protein-protein interaction interfaces

  • Vulnerability exploitation:

    • Develop antimicrobials that specifically target bacteria with modified membranes

    • Create combination therapies where one agent induces ArnF overexpression while another targets the resulting membrane vulnerabilities

    • Design molecules that hijack the ArnF transport system to deliver toxic compounds

  • Resistance mechanism circumvention:

    • Develop antimicrobials that maintain efficacy despite membrane modifications

    • Create compounds that bypass the protection normally provided by ArnF activity

    • Design treatments that exploit metabolic costs associated with ArnF upregulation

The therapeutic potential is particularly significant given that S. dysenteriae causes severe dysentery with mortality rates of up to 20% in outbreaks across developing regions . Research models suggest that ArnF inhibition could potentially re-sensitize resistant strains to existing antibiotics, particularly polymyxins and cationic antimicrobial peptides.

What experimental approaches would best characterize the evolutionary conservation of ArnF across pathogenic bacterial species?

Characterizing evolutionary conservation of ArnF requires an integrated approach combining multiple disciplines:

  • Comparative genomics framework:

    • Conduct systematic phylogenetic analysis across bacterial phyla

    • Implement selection pressure analysis to identify conserved vs. rapidly evolving regions

    • Apply ancestral sequence reconstruction to trace evolutionary trajectory

    • Develop coevolution analysis to identify functionally linked proteins

  • Structural conservation assessment:

    • Compare predicted structures across diverse bacterial species

    • Identify structurally invariant regions through comparative modeling

    • Implement molecular dynamics simulations to assess conservation of dynamic properties

    • Map conservation onto structural models to identify functionally critical domains

  • Functional conservation validation:

    • Perform cross-species complementation studies

    • Develop chimeric proteins combining domains from different species

    • Measure substrate specificity across orthologs

    • Quantify functional parameters (transport rates, substrate affinities) for comparative analysis

  • Environmental adaptation characterization:

    • Analyze ArnF variants from bacteria in different ecological niches

    • Correlate sequence/structural features with environmental conditions

    • Study ArnF in non-pathogenic relatives to identify pathogenicity-specific adaptations

    • Implement experimental evolution to observe ArnF adaptation in real-time

This systematic approach would provide valuable insights into which ArnF features represent ancestral functions versus recent adaptations, guiding both fundamental understanding and antimicrobial development strategies .

What are the most promising interdisciplinary approaches for studying the relationship between ArnF activity and Shigella dysenteriae virulence?

Understanding the relationship between ArnF activity and S. dysenteriae virulence requires integrating multiple research disciplines:

  • Systems biology integration:

    • Develop comprehensive network models linking membrane modification to virulence pathways

    • Implement transcriptomic and proteomic profiling under varying ArnF expression conditions

    • Apply metabolic flux analysis to connect lipid modification to energy metabolism and virulence factor production

    • Utilize genome-scale models to predict phenotypic consequences of ArnF perturbation

  • Host-pathogen interaction studies:

    • Employ tissue culture infection models with fluorescently-labeled bacteria expressing varied ArnF levels

    • Develop animal infection models to assess in vivo virulence correlations

    • Implement intravital microscopy to track membrane dynamics during infection

    • Analyze host immune response to bacteria with modified membrane compositions

  • Structural biology and biophysics:

    • Utilize cryo-EM to capture ArnF in different conformational states

    • Apply neutron reflectometry to study membrane structural changes

    • Implement hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Develop biosensors to track ArnF activity during infection processes

  • Synthetic biology approaches:

    • Create reporter strains with virulence factor expression linked to ArnF activity

    • Develop optogenetic control systems for spatiotemporal regulation of ArnF

    • Implement microfluidic organ-on-a-chip technologies for controlled infection studies

    • Design genetic circuits that amplify or attenuate ArnF activity in response to environmental cues

This interdisciplinary approach would provide a comprehensive understanding of how ArnF-mediated membrane modifications contribute to the pathogenicity of S. dysenteriae, potentially revealing new therapeutic targets and intervention strategies for controlling shigellosis outbreaks in developing regions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.