Recombinant Shigella dysenteriae serotype 1 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Protein Overview and Nomenclature

The term yciB refers to a conserved bacterial gene encoding a small inner membrane protein. In E. coli, YciB (also known as ydaS) is implicated in maintaining cell envelope integrity, working synergistically with DcrB to prevent membrane vesiculation and lysis . While yciB is annotated in Shigella genomes, its functional characterization in S. dysenteriae remains unexplored.

Key Attributes (Based on E. coli Data):

AttributeDescription
FunctionPutative role in intracellular septation and cell division regulation
Subcellular LocalizationInner membrane (IM) protein
InteractionsSynergy with DcrB to stabilize membrane structure
Expression SystemRecombinant production in E. coli (His-tagged for purification)

A. E. coli YciB/DcrB Complex

In E. coli, YciB and DcrB are essential for:

  • Membrane Stability: Preventing lipopolysaccharide (LPS) leakage and outer membrane (OM) vesiculation .

  • Envelope Integrity: Maintaining proper peptidoglycan synthesis and protein targeting .

  • Stress Response: Activation of Cpx signaling pathways under envelope stress .

Experimental Evidence:

  • Deletion of both yciB and dcrB leads to:

    • Lethal Membrane Defects: Dynamic membrane shrinkage and lysis.

    • Stalled Lpp Lipoprotein: Accumulation at the periplasmic face of the IM .

B. Shigella flexneri YfiB: A Regulatory Counterpart

While yciB is uncharacterized in Shigella, yfiB (a distinct gene) encodes an outer membrane protein critical for virulence in S. flexneri:

FeatureYfiB Function
Signaling RoleRegulates c-di-GMP levels via the YfiBNR tripartite system .
Virulence ImpactControls biofilm formation, invasion, and host adhesion .
Structural DataPredicted homology to Pseudomonas YfiB; critical residues identified via mutagenesis .

Gaps in Shigella dysenteriae yciB Research

  • Conservation: yciB is present in Shigella genomes (e.g., S. flexneri, S. sonnei) but often as a pseudogene in some strains .

  • Potential Role: Likely analogous to E. coli YciB in maintaining membrane stability, though S. dysenteriae’s virulence plasmid may alter this.

Commercial Availability (Indirect Evidence):

  • E. coli yciB: Recombinant His-tagged versions are sold for research (e.g., Creative Biomart) .

  • Shigella dysenteriae YCBG: A distinct recombinant protein (OPCA230373) is marketed for Western blot/ELISA applications, though its relation to yciB is unclear .

Hypothesized Mechanisms and Research Priorities

Based on E. coli and Shigella flexneri models, S. dysenteriae yciB may:

  1. Stabilize Membrane Architecture: Prevent OM vesiculation during intracellular replication.

  2. Modulate Stress Responses: Interact with chaperones (e.g., Skp) to manage envelope stress .

  3. Regulate Virulence: Indirectly influence invasion or persistence via membrane stability.

Experimental Approaches Needed:

  • Knockout Studies: Assess yciB deletion mutants for growth defects or virulence attenuation.

  • Protein Interactions: Map partners (e.g., DcrB homologs) using co-IP or yeast two-hybrid.

  • Structural Analysis: Predict tertiary structure via homology modeling (e.g., E. coli YciB).

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; SDY_1318; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATTALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: sdy:SDY_1318

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does yciB contribute to virulence in Shigella dysenteriae?

The yciB gene has been identified as a critical virulence-associated gene in Shigella dysenteriae through plaque assay screening of bacterial mutants. Studies demonstrate that loss of the yciB gene results in the inability of S. dysenteriae to form plaques in cell monolayers, which is a key indicator of attenuated virulence .

The specific mechanisms by which yciB contributes to virulence include:

  • Intracellular growth regulation: Loss of YciB results in significant intracellular growth defects, impairing the ability of S. dysenteriae to proliferate within host cells .

  • Cell division and septation: As a probable intracellular septation protein, yciB plays an essential role in bacterial cell division, which is critical for replication during infection .

  • Cell envelope integrity: The protein is involved in synthesis of the cell envelope, which is vital for maintaining bacterial integrity during infection and may contribute to resistance against host defense mechanisms .

  • Environmental adaptation: Deletion mutants of yciB show increased susceptibility to low osmolarity conditions, suggesting a role in adaptation to changing environmental conditions during infection .

The identification of yciB as responsible for the avirulent phenotype of strain SDU380 confirms its importance in S. dysenteriae pathogenesis and suggests it could be a potential target for therapeutic intervention .

What is the relationship between yciB in S. dysenteriae and its homologs in other bacterial species?

The yciB gene in S. dysenteriae is a homolog of the ispA gene in Shigella flexneri, which is an established virulence gene . Comparative analysis reveals significant conservation across Shigella species and related enterobacteria:

SpeciesProtein NameKey FunctionsSequence Similarity
S. dysenteriaeYciBVirulence, intracellular growth, septationReference
S. flexneriIspASeptation, virulenceHigh (>90%)
E. coliProbable intracellular septation protein ACell division, septationHigh (>90%)

In Escherichia coli, the yciB homolog (designated as "Probable intracellular septation protein A") shares high sequence similarity with the S. dysenteriae protein, with conserved transmembrane domains and functional regions . The protein in E. coli is also referred to as "Inner membrane-spanning protein YciB" .

Studies in S. flexneri have shown that YciB (IspA) plays a critical role in septation during cell division. Similarly, in S. dysenteriae, loss of YciB results in intracellular growth defects . The high degree of conservation across different bacterial species suggests that yciB serves a fundamental function in bacterial physiology, particularly in cell division and envelope maintenance, while also contributing to pathogen-specific virulence mechanisms .

What are the optimal expression systems for producing recombinant yciB protein?

Successful expression and purification of recombinant yciB protein presents challenges due to its multiple transmembrane domains. Based on current research, the following expression systems and conditions have proven most effective:

  • Expression System Selection:

    • E. coli-based systems are preferred, with BL21(DE3) strain showing reliable expression of full-length yciB protein .

    • The protein can be expressed with N-terminal His-tags to facilitate purification .

  • Vector and Construct Design:

    • Vectors with tightly controlled promoters (like pET series) minimize toxicity associated with membrane protein overexpression.

    • Including the complete coding sequence (1-179 amino acids) is critical for structural integrity .

  • Expression Conditions:

    • Induction at lower temperatures (16-20°C) improves solubility and reduces inclusion body formation.

    • Addition of membrane-stabilizing agents in the culture medium enhances yield.

  • Purification Protocol:

    • Cell lysis using appropriate buffer systems containing mild detergents.

    • Immobilized metal affinity chromatography (IMAC) using the His-tag.

    • Size exclusion chromatography for further purification.

    • Final storage in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

  • Stability Considerations:

    • Store as lyophilized powder or in solution with 50% glycerol .

    • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles.

    • Working aliquots can be maintained at 4°C for up to one week .

For reconstitution, it is recommended to dissolve the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a stabilizing agent . These optimized conditions ensure maximum yield and stability of the recombinant yciB protein for downstream applications.

How can researchers create and validate yciB knockout mutants in S. dysenteriae?

Creating and validating yciB knockout mutants in S. dysenteriae requires precise genetic manipulation techniques and thorough validation. The following methodology has been successfully employed:

  • Knockout Construction Strategies:

    • Homologous recombination using suicide vectors containing flanking regions of the yciB gene.

    • Lambda Red recombinase-based systems for precise deletion without polar effects.

    • Non-directed mutagenesis followed by screening (as was the case with strain SDU380) .

  • Selection and Screening:

    • Use of appropriate antibiotic resistance markers for selection.

    • PCR-based screening to identify putative deletion mutants.

    • Sequence verification to confirm precise deletion boundaries.

  • Rigorous Validation Methods:

    • Genomic verification: PCR and sequencing to confirm the deletion.

    • Transcriptional analysis: RT-PCR or RNA-seq to confirm absence of yciB transcription.

    • Protein analysis: Western blotting with anti-YciB antibodies to confirm absence of the protein.

    • Complementation studies: Reintroduction of the wild-type yciB gene to restore phenotype, confirming that observed defects are due specifically to yciB deletion .

  • Phenotypic Characterization:

    • Plaque assay: Testing the ability to form plaques in cell monolayers .

    • Intracellular growth assays: Quantification of bacterial replication within host cells.

    • Microscopic examination: Assessment of cell morphology and division patterns.

    • Osmotic stress response: Testing growth under varying osmolarity conditions .

The study by researchers at the University of Texas demonstrated the effectiveness of creating specific yciB deletion mutants by constructing strains missing only some of the genes deleted in the original SDU380 mutant. This approach allowed them to pinpoint yciB as the critical gene responsible for the plaque formation defect, which was further confirmed through complementation studies .

What plaque assay protocols are most effective for evaluating yciB's role in virulence?

The plaque assay is a critical method for assessing yciB's contribution to S. dysenteriae virulence, as it measures the bacteria's ability to invade, grow within, and spread between eukaryotic cells. The following optimized protocol is recommended based on successful research applications:

  • Cell Line Selection and Preparation:

    • HeLa or Caco-2 epithelial cell lines provide consistent results for Shigella plaque assays.

    • Seed cells to form confluent monolayers (approximately 90-95% confluence) in appropriate tissue culture plates.

    • Maintain cells in antibiotic-free medium for 24 hours prior to infection.

  • Bacterial Strain Preparation:

    • Culture the wild-type S. dysenteriae, yciB knockout mutant, and complemented strains to mid-logarithmic phase.

    • Standardize bacterial suspensions to ensure equivalent inoculum across strains.

    • Include appropriate controls: wild-type (positive control), known avirulent mutant (negative control), and complemented mutant.

  • Infection Procedure:

    • Infect cell monolayers with standardized bacterial suspensions.

    • Allow invasion to occur (typically 60-90 minutes).

    • Wash and add medium containing gentamicin to kill extracellular bacteria.

  • Plaque Development and Visualization:

    • Apply an agarose overlay containing reduced gentamicin concentration.

    • Incubate for 48-72 hours to allow plaque formation.

    • Stain with crystal violet or neutral red for visualization.

    • Document using photography and quantify plaque size and number.

  • Quantitative Analysis:

    • Measure plaque diameter using image analysis software.

    • Calculate plaque formation efficiency (number of plaques/CFU of inoculum).

    • Compare plaque characteristics between wild-type, mutant, and complemented strains.

The plaque assay has proven highly effective in demonstrating that loss of the yciB gene results in the complete inability of S. dysenteriae to form plaques, indicating its essential role in virulence . This assay provides a visual and quantifiable measure of the bacteria's ability to complete the entire infection cycle, making it an invaluable tool for assessing the contribution of virulence-associated genes like yciB.

How does yciB interact with cell elongation and division proteins?

The yciB protein has been characterized as interacting with various proteins involved in bacterial cell elongation and division, highlighting its integrated role in these essential processes. These interactions have been identified through bacterial two-hybrid systems and other protein-protein interaction methodologies .

Key interaction partners and their functional relationships with yciB include:

  • Cell Elongation Complex Interactions:

    • YciB interacts with components of the elongation machinery responsible for lateral cell wall synthesis.

    • These interactions suggest that yciB may contribute to coordinating cell envelope expansion during growth.

    • Disruption of these interactions in yciB mutants may contribute to the observed growth defects.

  • Divisome Component Interactions:

    • YciB has been found to interact with proteins in the bacterial divisome, the multi-protein complex responsible for cell division.

    • These interactions suggest a role in coordinating septum formation during division.

    • The membrane localization of yciB positions it ideally to serve as a bridge between cytoplasmic and periplasmic division components.

  • Functional Significance of Interactions:

    • The interaction network positions yciB as a potential coordinator between elongation and division processes.

    • These interactions may be regulated in response to environmental conditions or cell cycle stage.

    • Disruption of the interaction network in yciB mutants may lead to impaired cell division and consequent virulence defects.

Research has demonstrated that these protein-protein interactions are critical for normal cell envelope synthesis, with yciB potentially serving as a linker between different complexes involved in cell growth and division . The susceptibility of yciB deletion mutants to low osmolarity conditions further supports the protein's role in maintaining cell envelope integrity through these interactions .

What molecular mechanisms underlie yciB's role in intracellular growth defects?

The intracellular growth defects observed in yciB deletion mutants of S. dysenteriae involve multiple molecular mechanisms that collectively impact bacterial survival and replication within host cells:

  • Cell Envelope Integrity:

    • YciB contributes to proper cell envelope synthesis and maintenance.

    • The compromised envelope integrity in yciB mutants likely increases susceptibility to intracellular stresses.

    • Proper membrane composition is crucial for resistance to host antimicrobial peptides and defense mechanisms.

  • Septation and Cell Division:

    • As an intracellular septation protein, yciB is involved in the formation of the septum during cell division.

    • In S. flexneri, the yciB homolog (ispA) has been established as playing a role in septation .

    • Defective septation in yciB mutants impairs bacterial replication within host cells.

  • Stress Response and Adaptation:

    • YciB appears to contribute to bacterial adaptation to the challenging intracellular environment.

    • The increased susceptibility to low osmolarity conditions in yciB mutants suggests impaired ability to adapt to osmotic changes encountered within host cells .

    • This may reflect a broader role in stress response pathways critical for intracellular survival.

  • Potential Metabolic Connections:

    • The membrane localization of yciB may affect transport systems essential for nutrient acquisition within host cells.

    • Changes in membrane properties could influence metabolic adaptations required for intracellular growth.

The combination of these mechanisms explains why yciB is essential for the formation of plaques in cell monolayers, as the plaque assay measures the bacteria's ability to invade, replicate within, and spread between host cells—all processes that depend on proper cell division and adaptation to the intracellular environment .

How does the membrane topology of yciB influence its functional interactions?

The membrane topology of yciB, with its five transmembrane domains, is fundamental to its function and interactions with other cellular components. This topology has been experimentally confirmed using dual pho-lac reporter systems :

  • Transmembrane Domain Organization:

    • The five transmembrane segments anchor yciB within the inner membrane.

    • This arrangement creates specific cytoplasmic and periplasmic loops that serve as interaction interfaces.

    • The orientation of N- and C-termini relative to the membrane provides additional interaction surfaces.

  • Functional Implications of Topology:

    • The transmembrane domains likely form a structural framework that positions the functional loops appropriately.

    • These domains may directly participate in sensing membrane properties or stress conditions.

    • The specific arrangement may create a channel or pocket with functional significance for septation or membrane integrity.

  • Loop Regions and Protein Interactions:

    • Cytoplasmic loops can interact with cytoskeletal elements or cytoplasmic proteins involved in cell division.

    • Periplasmic loops may interact with components of the peptidoglycan synthesis machinery.

    • These interactions bridge processes occurring on either side of the membrane, positioning yciB as a coordinator of envelope synthesis.

  • Evolutionary Conservation:

    • The five-transmembrane domain structure is conserved across yciB homologs in different bacterial species.

    • This conservation suggests that the specific topology is essential for the protein's function in cell division and virulence.

    • Variations in loop regions may reflect species-specific adaptations to different environmental niches.

The membrane topology of yciB provides a structural basis for understanding how mutations or deletions affect its function, particularly in the context of the protein's role in cell division, septation, and consequently, virulence in S. dysenteriae .

How can researchers distinguish between direct and indirect effects of yciB deletion?

Differentiating between direct and indirect effects of yciB deletion is critical for accurately interpreting experimental results and understanding the protein's primary functions. The following methodological approaches enable this distinction:

  • Complementation Analysis:

    • Reintroduction of the wild-type yciB gene should restore phenotypes directly caused by yciB deletion.

    • Partial complementation may indicate indirect effects or polar effects on neighboring genes.

    • The successful restoration of plaque formation in complemented S. dysenteriae yciB mutants demonstrates a direct role of yciB in this virulence-associated phenotype .

  • Temporal Analysis:

    • Direct effects typically manifest immediately after gene inactivation.

    • Indirect effects often appear as downstream consequences of primary defects.

    • Time-course experiments following yciB inactivation can reveal the sequence of phenotypic changes.

  • Molecular Pathway Analysis:

    • Transcriptomics (RNA-seq) can identify genes whose expression changes in response to yciB deletion.

    • Proteomics can detect alterations in protein levels or post-translational modifications.

    • Network analysis can map direct and indirect interactions affected by yciB deletion.

  • Structure-Function Analysis:

    • Site-directed mutagenesis of specific domains or residues in yciB.

    • Correlation between specific mutations and phenotypic effects helps define direct functions.

    • The five transmembrane domain structure of yciB provides targets for such analysis .

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid systems have successfully identified proteins that directly interact with yciB .

    • These interaction partners are likely involved in processes directly affected by yciB deletion.

    • The identification of interactions with cell elongation and division proteins supports yciB's direct role in these processes .

By integrating these approaches, researchers can build a comprehensive understanding of yciB's direct functions in cell division, septation, and virulence, distinguishing them from secondary effects that arise as consequences of these primary defects.

What analytical approaches best characterize the effect of yciB on bacterial cell morphology?

Characterizing the effect of yciB on bacterial cell morphology requires a combination of microscopic, molecular, and computational approaches to capture both qualitative and quantitative changes:

  • Advanced Microscopy Techniques:

    • Phase-contrast microscopy for basic morphological assessment.

    • Fluorescence microscopy with membrane-specific dyes to visualize membrane integrity.

    • Time-lapse microscopy to observe division defects in real-time.

    • Electron microscopy (TEM/SEM) for ultrastructural analysis of cell envelope and septation abnormalities.

  • Fluorescent Tagging Strategies:

    • Fluorescent fusion proteins targeting division ring components (e.g., FtsZ-GFP).

    • Peptidoglycan-specific fluorescent probes to visualize cell wall synthesis.

    • Dual-color imaging to simultaneously track multiple cellular components.

  • Quantitative Morphometric Analysis:

    • Automated image analysis to measure cell length, width, and shape parameters.

    • Statistical comparison of morphological distributions between wild-type and yciB mutants.

    • Population-level analysis to identify subpopulations with distinct morphological phenotypes.

  • Correlation with Molecular Data:

    • Combine morphological analysis with gene expression data for key division genes.

    • Relate structural changes to alterations in protein localization patterns.

    • Integrate with proteomic data on cell envelope composition.

  • Environmental Variation Testing:

    • Assess morphological changes under various conditions (osmolarity, pH, temperature).

    • The known susceptibility of yciB mutants to low osmolarity suggests this parameter is particularly relevant .

    • Compare intracellular morphology to that observed in laboratory media.

This multi-faceted approach allows researchers to characterize the specific morphological consequences of yciB deletion, providing insights into the protein's role in maintaining proper cell shape and division—processes critical for bacterial viability and virulence. The connection between these morphological effects and the intracellular growth defects observed in yciB mutants can further illuminate the mechanism by which yciB contributes to S. dysenteriae pathogenesis.

How do environmental factors modulate yciB expression and function?

Environmental factors significantly influence yciB expression and function, reflecting the protein's role in adapting bacterial physiology to changing conditions encountered during infection. Understanding these environmental influences provides insights into when and where yciB function is most critical:

  • Osmolarity Effects:

    • YciB deletion mutants show pronounced susceptibility to low osmolarity conditions .

    • This suggests yciB plays a critical role in maintaining cell envelope integrity under osmotic stress.

    • During infection, bacteria encounter varying osmolarity levels in different host compartments, making this adaptation particularly relevant to virulence.

  • Growth Phase Regulation:

    • YciB function appears particularly important during specific growth phases.

    • As a septation protein, its activity is likely coordinated with cell cycle progression.

    • The expression pattern may shift from exponential to stationary phase, reflecting changing physiological priorities.

  • Intracellular Environment Adaptation:

    • The requirement for yciB in intracellular growth indicates its importance in adapting to the host cell environment.

    • This environment presents unique challenges including nutrient limitation, antimicrobial factors, and pH changes.

    • YciB may respond to these stresses by modulating cell envelope properties or division patterns.

  • Host-Pathogen Interface Factors:

    • Interaction with host cell components may trigger changes in yciB expression or function.

    • The protein's role in virulence suggests it responds to host-derived signals or stresses.

    • These responses likely contribute to successful colonization and infection progression.

  • Methodological Approaches for Study:

    • Transcriptional reporters (e.g., yciB-lacZ fusions) to monitor expression under different conditions.

    • Proteomics to assess protein levels and modifications in response to environmental changes.

    • Membrane integrity assays under varying conditions to assess functional consequences.

    • In vitro models that mimic specific host environments.

The modulation of yciB by environmental factors aligns with its dual role in basic cellular processes (septation, cell division) and virulence-specific functions (intracellular growth, plaque formation). Understanding these environmental influences is essential for developing intervention strategies that target yciB function under the specific conditions where it is most critical for pathogenesis .

How does yciB function differ between S. dysenteriae and other Shigella species?

Comparative analysis of yciB across different Shigella species reveals both conserved functions and species-specific variations that may contribute to differences in virulence and host adaptation:

  • Sequence and Structural Conservation:

    • The yciB gene shows high sequence conservation across Shigella species, indicating its fundamental importance.

    • In S. flexneri, the yciB homolog is known as ispA and has been established as a virulence gene involved in septation .

    • S. dysenteriae yciB maintains the five-transmembrane domain structure observed in other species .

  • Functional Differences:

    • In S. dysenteriae, yciB deletion results in complete inability to form plaques in cell monolayers .

    • S. flexneri ispA (yciB) mutants show similar septation defects but may have somewhat different effects on intracellular growth .

    • These differences may reflect adaptation to the specific pathogenic strategies of each species.

  • Virulence Contribution:

    • The relative importance of yciB for virulence varies across Shigella species.

    • S. dysenteriae serotype 1 is associated with particularly severe disease, and yciB appears to be essential for its virulence .

    • These variations may contribute to the distinct clinical presentations associated with different Shigella species.

  • Environmental Response Patterns:

    • The response of yciB to environmental factors may differ between species.

    • S. dysenteriae yciB mutants show increased susceptibility to low osmolarity .

    • Species-specific regulatory mechanisms may control yciB expression in response to different environmental cues.

This comparative understanding of yciB function across Shigella species has important implications for the development of targeted interventions. The essential role of yciB in S. dysenteriae virulence makes it a particularly attractive target for this highly pathogenic species, while the conservation across species suggests potential for broader application in controlling Shigella infections .

What evolutionary insights emerge from analyzing yciB across bacterial species?

Evolutionary analysis of yciB across bacterial species provides valuable insights into its origin, functional conservation, and adaptation to different ecological niches:

The evolutionary history of yciB illuminates how basic cellular processes can be repurposed for virulence functions during pathogen evolution. The protein's role in both fundamental cell division processes and specific virulence mechanisms makes it a particularly interesting case study in bacterial evolution .

How does the yciB protein from S. dysenteriae compare functionally with recombinant versions?

Recombinant versions of yciB protein from S. dysenteriae serve as valuable tools for research, but their functional properties compared to the native protein require careful consideration:

These considerations are essential when using recombinant yciB for functional studies, structural analysis, or as a tool for developing therapeutic interventions targeting this virulence factor. Understanding the relationship between recombinant and native forms ensures that research findings accurately reflect the protein's biological role in S. dysenteriae pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.