Recombinant Shigella dysenteriae serotype 1 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming a thioether bond . This post-translational modification is essential for:

  • Lipoprotein maturation: Anchoring lipoproteins to the bacterial membrane.

  • Virulence: Enabling pathogenicity in Shigella and related species by stabilizing virulence factors .

  • Cell viability: Depletion of Lgt in E. coli leads to growth arrest, underscoring its indispensability .

Membrane Topology

Lgt is an inner membrane protein with seven transmembrane segments. Key structural attributes include:

  • N-terminal periplasmic orientation and C-terminal cytoplasmic orientation .

  • Conserved residues: Y26, N146, and G154 are critical for enzymatic activity, while R143, E151, R239, and E243 enhance substrate binding .

Signature Motif

A conserved "Lgt motif" (e.g., YxxNxxE) faces the periplasm and facilitates interactions with prolipoprotein substrates .

FeatureDescription
Catalytic ResiduesY26, N146, G154 (essential); R143, E151, R239, E243 (critical for activity)
Membrane Segments7 transmembrane helices
Substrate SpecificityRecognizes the lipobox motif (LxxC) in prolipoproteins

Recombinant Lgt Production

Although recombinant Shigella dysenteriae Lgt has not been explicitly documented, homologous systems provide production frameworks:

  • Expression Hosts: Typically E. coli due to its well-characterized lipoprotein processing machinery .

  • Purification: His-tagged recombinant Lgt from N. multiformis (Q2YC65) yields ~0.57 mg/mL post-purification .

  • Applications: Vaccine development (e.g., truncated IpaD in Shigella) and antibiotic target exploration .

Pathogenesis and Virulence

  • Lipoprotein-dependent mechanisms: Lgt-modified lipoproteins in Shigella contribute to immune evasion and host cell invasion .

  • Stress adaptation: Enzymes like HdeAB (regulated by PhoPQ) enhance acid tolerance, a trait critical for intestinal survival .

Therapeutic Targeting

  • Antibiotic development: Inhibiting Lgt disrupts lipoprotein anchoring, compromising bacterial integrity .

  • Vaccine candidates: Recombinant virulence factors (e.g., IpaD) are being tested for broad-spectrum protection against Shigella .

Challenges and Future Directions

  • Species-specific variation: Shigella Lgt may exhibit unique structural adaptations compared to E. coli or N. multiformis.

  • Antimicrobial resistance: Rising multidrug resistance in Shigella underscores the urgency for novel Lgt inhibitors .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. We encourage you to contact your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
lgt; SDY_3045; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, initiating the formation of mature lipoproteins.
Database Links

KEGG: sdy:SDY_3045

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme involved in bacterial lipoprotein biosynthesis. It catalyzes the transfer of diacylglyceryl moiety from phosphatidylglycerol (PG) to the conserved cysteine residue within the lipobox of preproproteins, which represents the first step in bacterial lipoprotein maturation. This post-translational modification is essential for proper bacterial membrane organization and function .

The X-ray crystal structure of Lgt reveals a complex architecture featuring transmembrane domains, a central cavity with two binding sites for the PG substrate, and specific catalytic residues. During the reaction mechanism, PG binds to the enzyme, and the diacylglyceryl moiety is transferred to the lipobox of the preprolipoprotein, with the modified lipoprotein then exiting through a side cleft of Lgt .

How does Shigella dysenteriae serotype 1 differ from other Shigella species, and why is it significant for Lgt research?

Shigella dysenteriae serotype 1 (SD1) causes the most severe form of epidemic bacillary dysentery compared to other Shigella species (S. boydii, S. flexneri, and S. sonnei). The distinctive feature of SD1 is its production of Shiga toxin 1 (Stx1), a potent cytotoxin that primarily targets microvascular endothelium and contributes to gastrointestinal bleeding .

SD1 is significant for Lgt research because it represents a high-priority pathogen with unique virulence characteristics. All analyzed SD1 strains harbor stx1 (Shiga toxin), ipaH (invasion plasmid antigen H), and ial (invasion-associated locus) genes, which contribute to its virulence profile . Additionally, the emergence of multidrug resistance in SD1, including resistance to fluoroquinolones (100% resistance to ciprofloxacin and norfloxacin in isolates from Kolkata, India), makes it an important target for alternative therapeutic approaches .

What is the epidemiological significance of Shigella dysenteriae serotype 1 infections?

Shigella dysenteriae serotype 1 causes the most severe form of epidemic bacillary dysentery globally. The bacterium has an extremely low infectious dose (10-100 organisms), allowing efficient transmission via the oral-fecal route through contaminated food or water . Shigellosis begins with acute infection of the cecum followed by bacterial invasion of the colonic mucosa, resulting in symptoms including cramps, diarrhea, and fever .

Epidemiologically, untreated SD1 infections can be fatal in 10-15% of cases, particularly affecting young children and immunocompromised patients. The global burden is estimated at approximately 1.1 million deaths annually, which remains alarmingly high despite prevention and treatment efforts . The rapid emergence of drug resistance in Shigella species toward β-lactams, tetracyclines, and aminoglycosides further complicates treatment strategies .

What is the detailed mechanism of Lgt-catalyzed lipid modification in bacterial systems?

The reaction mechanism of Lgt involves several coordinated steps:

  • Binding of phosphatidylglycerol (PG) substrate in the enzyme's active site

  • Activation of the conserved cysteine residue in the preprolipoprotein lipobox

  • Transfer of the diacylglyceryl moiety from PG to the activated cysteine

  • Release of the modified lipoprotein and the glycerol-1-phosphate head group

Molecular dynamics simulations and QM/MM calculations have revealed that His103 functions as a catalytic base in the diacylglyceryl transfer reaction. His103 abstracts a proton from the conserved cysteine residue of the preprolipoprotein, facilitating the nucleophilic attack on the C3-O ester bond of PG .

The C3-O ester bond of PG is activated through interactions with key residues, including Arg143, which forms electrostatic interactions with the phosphate O3 of the PG molecule and stable ionic interactions with Glu206. This organization of the active site is critical for efficient diacylglyceryl transfer. Mutagenesis studies have confirmed the importance of these residues for catalytic activity .

What structural features of Lgt are essential for its enzymatic function?

The X-ray crystal structure of Lgt reveals several essential structural features:

  • Transmembrane domains: Lgt contains multiple transmembrane helices (including two conserved motifs - one preceding TM1 and another between TM2 and TM3)

  • Central cavity: The enzyme has a central cavity containing two binding sites for the PG substrate

  • Active site: The second PG binding site serves as the active site where the diacylglyceryl transfer occurs

  • Side cleft: A cleft from which the modified lipobox exits after the reaction

The proper orientation of catalytically important residues, including Arg143 and Arg239, is facilitated by the glycerol head group in the PG molecule. These interactions organize the active site for efficient diacylglyceryl transfer . The protonation states of key residues also play a crucial role in the reaction mechanism. Specifically, His7 is protonated, while His24, His103, and His196 are in the neutral form with the epsilon nitrogen protonated, creating the optimal electrostatic environment for catalysis .

How does environmental adaptation affect Lgt expression and function in Shigella dysenteriae serotype 1?

Comprehensive proteome analysis of Shigella dysenteriae serotype 1 has revealed significant adaptations in protein expression between in vitro cultures and in vivo infection models. While Lgt-specific expression data is limited, general patterns of membrane protein adaptation provide insights into potential Lgt regulation .

During in vivo infection, S. dysenteriae shifts to anaerobic energy metabolism as evidenced by proteomic analysis of bacterial isolates from infected gnotobiotic piglets. The bacterium shows increased abundance of proteins involved in acid stress response, including amino acid decarboxylases (GadB and AdiA) that enhance pH homeostasis in the cytoplasm, and protein disaggregation chaperones (HdeA, HdeB, and ClpB) .

Type III secretion system (T3SS) effectors, including OspF, IpaC, and IpaD, also show increased abundance in vivo. These proteins are implicated in colonocyte invasion and subversion of the host immune response . These environmental adaptations suggest that membrane-associated enzymes like Lgt may similarly undergo expression changes to facilitate bacterial survival in the host environment.

What expression systems are most effective for producing recombinant S. dysenteriae Lgt?

For optimal expression of recombinant S. dysenteriae Lgt, several expression systems can be employed, each with specific advantages:

E. coli-based expression systems:

  • BL21(DE3) strain with pET vector system: Provides high-level expression under the control of the T7 promoter

  • C41(DE3) or C43(DE3) strains: Specially designed for membrane protein expression with reduced toxicity

  • Lemo21(DE3): Allows tunable expression through rhamnose-inducible control of T7 lysozyme levels

Key considerations for Lgt expression:

  • Use of weak promoters to prevent toxicity from overexpression

  • Addition of fusion tags (His6, MBP, or SUMO) to improve solubility and facilitate purification

  • Controlled induction with reduced IPTG concentrations (0.1-0.5 mM) and lower temperatures (16-25°C)

  • Supplementation with additional phospholipids to support proper folding

Codon optimization for E. coli expression is particularly important when expressing S. dysenteriae proteins to overcome potential codon bias issues. Since Lgt is a membrane protein with multiple transmembrane domains, detergent screening is critical for solubilization and maintaining enzymatic activity during purification .

What purification strategies yield functionally active recombinant S. dysenteriae Lgt?

Purification of functionally active recombinant S. dysenteriae Lgt requires specialized approaches for membrane proteins:

Membrane preparation and solubilization:

  • Cell disruption by sonication or high-pressure homogenization

  • Membrane fraction isolation through differential centrifugation

  • Systematic detergent screening (commonly DDM, LDAO, or CHAPS) for optimal solubilization

Chromatographic purification methods:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

  • Size exclusion chromatography for removing aggregates and detergent micelles

  • Ion exchange chromatography as a polishing step

To maintain Lgt activity throughout purification, specific buffer components are critical:

  • Glycerol (10-20%) to stabilize protein structure

  • Reducing agents (5-10 mM DTT or 2-5 mM β-mercaptoethanol) to maintain cysteine residues

  • Appropriate detergent concentration (above critical micelle concentration)

  • pH optimization (typically pH 7.5-8.0) based on predicted isoelectric point

After purification, enzyme activity should be validated using a phosphatidylglycerol-dependent diacylglyceryl transfer assay to ensure the recombinant protein maintains its native function .

How can researchers assess the enzymatic activity of recombinant S. dysenteriae Lgt in vitro?

Several methods can be used to assess the enzymatic activity of recombinant S. dysenteriae Lgt in vitro:

1. Radiolabeled substrate assay:

  • Using [³H]-labeled or [¹⁴C]-labeled phosphatidylglycerol as substrate

  • Detection of radiolabeled diacylglyceryl transfer to acceptor peptides containing lipobox motifs

  • Quantification by thin-layer chromatography or scintillation counting

2. Fluorescence-based assays:

  • FRET-based assays using fluorescently labeled substrates

  • Continuous monitoring of activity using environmentally sensitive fluorophores

  • High-throughput screening capability for inhibitor studies

3. Mass spectrometry approaches:

  • Direct detection of reaction products using LC-MS/MS

  • Monitoring the conversion of preprolipoprotein to its diacylglyceryl form

  • Structural characterization of modified peptides

4. Coupled enzyme assays:

  • Detection of glycerol-1-phosphate release through coupling to additional enzymatic reactions

  • Spectrophotometric or fluorometric readout options

  • Suitable for kinetic analysis and inhibitor screening

The in vitro assay conditions should mimic the native enzyme environment with:

  • Detergent micelles or liposomes to provide a membranous environment

  • Optimized pH (typically 7.0-8.0) and temperature (30-37°C)

  • Inclusion of divalent cations (Mg²⁺ or Mn²⁺) that may enhance activity

  • Synthetic peptide substrates containing the consensus lipobox sequence (LLAGC)

How might targeting Lgt in S. dysenteriae affect bacterial pathogenicity?

Targeting Lgt in S. dysenteriae represents a promising antimicrobial strategy because:

  • Lgt catalyzes the first step in bacterial lipoprotein biosynthesis, which is essential for membrane integrity and function

  • Inhibition of Lgt would disrupt multiple lipoprotein-dependent processes simultaneously

  • Lipoproteins are critical for bacterial pathogenicity, including adherence, invasion, and immune evasion

The inhibition of Lgt could specifically impact S. dysenteriae pathogenicity by:

  • Reducing membrane stability and increasing susceptibility to host defense mechanisms

  • Disrupting T3SS function, which depends on proper membrane organization

  • Preventing localization of lipoproteins involved in nutrient acquisition

  • Compromising bacterial adaptation to the host environment, including acid stress response

Given the rising antimicrobial resistance in S. dysenteriae strains, including 100% resistance to fluoroquinolones in some regions , Lgt inhibitors could provide an alternative therapeutic approach targeting a pathway not affected by current resistance mechanisms.

What role might S. dysenteriae Lgt play in vaccine development strategies?

S. dysenteriae Lgt could contribute to vaccine development strategies in several ways:

  • As a target for attenuated live vaccine strains:

    • Lgt mutants with reduced function could create attenuated strains with decreased virulence

    • Modified Lgt activity could alter lipoprotein processing, potentially affecting immune recognition

  • As a protein carrier for conjugate vaccines:

    • Recombinant Lgt could serve as a carrier protein for S. dysenteriae O-antigens

    • A quadrivalent vaccine containing O antigens from multiple Shigella serotypes has shown promise in providing broad protection

  • For bacterial outer membrane vesicle (OMV) vaccine development:

    • Modifying Lgt could alter the composition of bacterial membrane vesicles

    • Engineered OMVs could have reduced toxicity and improved immunogenicity

Current research suggests that a broadly protective Shigella vaccine should include O antigens from S. sonnei, S. flexneri 2a, S. flexneri 3a, and S. flexneri 6 . Understanding Lgt's role in lipoprotein processing could inform strategies to optimize antigen presentation and immunogenicity in these vaccine approaches.

What challenges exist in developing Lgt inhibitors as potential antimicrobials against S. dysenteriae?

Development of Lgt inhibitors as antimicrobials against S. dysenteriae faces several significant challenges:

1. Structural and functional considerations:

  • Lgt is a membrane-embedded enzyme with multiple transmembrane domains

  • Limited high-resolution structural information specifically for S. dysenteriae Lgt

  • Complexity of assessing inhibitor penetration into the membrane environment

2. Selectivity concerns:

  • Need for selective targeting of bacterial Lgt without affecting host enzymes

  • Potential differences in Lgt structure across bacterial species requiring pathogen-specific approaches

  • Balance between broad-spectrum activity and selectivity

3. Pharmacokinetic and delivery challenges:

  • Ensuring inhibitor penetration through the outer membrane of gram-negative bacteria

  • Achieving sufficient concentration at the periplasmic membrane where Lgt is located

  • Addressing potential efflux pump-mediated resistance mechanisms

4. Validation requirements:

  • Demonstrating in vivo efficacy beyond biochemical inhibition

  • Establishing appropriate animal models that recapitulate human S. dysenteriae infection

  • Addressing potential compensatory mechanisms that may emerge upon Lgt inhibition

To overcome these challenges, structure-based drug design approaches utilizing the crystal structure information of E. coli Lgt (PDB: 5AZC) and molecular docking studies could guide rational inhibitor development . Focusing on the catalytic residues identified through QM/MM calculations, particularly His103, could provide starting points for targeted inhibitor design.

What is the relationship between Lgt function and antimicrobial resistance in S. dysenteriae?

The relationship between Lgt function and antimicrobial resistance in S. dysenteriae represents an emerging area of research:

Direct connections:

  • Lipoproteins processed by Lgt may include components of efflux pumps that contribute to antibiotic resistance

  • Proper membrane organization, dependent on Lgt function, is critical for the activity of many resistance mechanisms

Epidemiological context:
S. dysenteriae serotype 1 strains have shown alarming rates of antimicrobial resistance, including:

  • 100% resistance to ampicillin, tetracycline, co-trimoxazole, nalidixic acid, norfloxacin, and ciprofloxacin

  • 80% resistance to chloramphenicol

This multidrug resistance profile complicates treatment of shigellosis, creating urgency for new therapeutic approaches. Given that Lgt operates in a pathway distinct from those targeted by current antibiotics, it presents a potential strategy to overcome existing resistance mechanisms.

Research opportunities:

  • Investigating whether Lgt inhibition can restore sensitivity to conventional antibiotics

  • Exploring potential synergistic effects between Lgt inhibitors and existing antimicrobials

  • Determining if resistance to Lgt inhibition could develop and through what mechanisms

How does the host environment affect S. dysenteriae Lgt expression and activity during infection?

Proteome analysis of S. dysenteriae during infection provides insights into how the host environment affects bacterial adaptation, which may extend to Lgt expression and activity:

Environmental adaptation:
When transitioning from in vitro culture to in vivo infection in the large bowel of gnotobiotic piglets, S. dysenteriae undergoes significant proteome remodeling, including:

  • Switching to anaerobic energy metabolism

  • Increasing abundance of acid stress response proteins (GadB, AdiA)

  • Upregulating protein disaggregation chaperones (HdeA, HdeB, ClpB)

  • Enhancing expression of T3SS effectors (OspF, IpaC, IpaD)

These adaptations suggest that membrane-associated enzymes like Lgt may also undergo regulatory changes to support bacterial survival in the host. The acidic environment of the gut likely influences Lgt activity, as the enzyme's optimal function depends on proper protonation states of key residues .

Host-pathogen interface considerations:

  • Interaction with host immune factors may alter lipid availability and composition

  • Exposure to antimicrobial peptides may trigger changes in membrane protein expression

  • Nutrient limitation in the host environment may affect phospholipid availability as Lgt substrates

Understanding these host-dependent modulatory effects on Lgt could inform more effective therapeutic strategies targeting this enzyme during actual infection conditions rather than standard laboratory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.