Recombinant Shigella dysenteriae serotype 1 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; SDY_0547; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links

KEGG: sdy:SDY_0547

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog protein in Shigella dysenteriae serotype 1?

The CrcB homolog in Shigella dysenteriae serotype 1 is a membrane protein that likely functions as a fluoride ion channel. This protein belongs to a conserved family of bacterial membrane proteins that provide protection against fluoride toxicity by exporting fluoride ions from the cytoplasm. In the context of S. dysenteriae, CrcB is encoded within the bacterial genome, which has been sequenced and analyzed for strains like Sd1617 (used as a model for vaccine design) with a chromosome size of approximately 4.34 Mb . The genomic context of crcB in S. dysenteriae can be understood by comparing it with the complete genome sequences that have been deposited in GenBank for strains such as Sd197 .

CrcB proteins typically contain approximately 100-120 amino acids and form homooligomeric structures with multiple membrane-spanning domains. The protein's structure facilitates the selective transport of fluoride ions across the bacterial cell membrane, which is crucial for maintaining cellular homeostasis in environments containing fluoride. While not directly mentioned in the proteome analysis of S. dysenteriae, this protein would likely be classified among the membrane transport proteins that were identified in comprehensive proteomic surveys .

How is the crcB gene organized in the Shigella dysenteriae genome?

The crcB gene in S. dysenteriae is part of the bacterial chromosome rather than located on the virulence plasmid. Genomic analyses of S. dysenteriae strains, including Sd197 and Sd1617, have revealed that the chromosome contains approximately 4.3 Mb with an average GC content of about 50% . Within this genomic context, the crcB gene is typically present as part of the bacterial "backbone" - the approximately 3 Mb of genetic material shared among Shigella and E. coli genomes that accounts for about 65% of the coding capacity .

The specific organization of crcB can be understood through genomic comparison tools like GenomeComp, which has been used to compare Shigella genomes . The gene typically exists as a single copy, though it may be part of an operon structure in some bacterial species. In the context of S. dysenteriae, genome annotation procedures using tools like Glimmer, CRITICA, and Prokpeg have identified thousands of ORFs on the chromosome, with over 82% of these receiving functional annotations . The crcB gene would be among these annotated sequences, identifiable through protein sequence similarity searches.

What expression systems are suitable for producing recombinant CrcB protein?

For recombinant expression of the S. dysenteriae CrcB homolog protein, several expression systems can be employed, with selection depending on research objectives:

  • E. coli-based expression systems: Given the close genetic relationship between Shigella and E. coli (sharing approximately 3 Mb common backbone) , E. coli expression systems like BL21(DE3) are logical first choices. These systems are particularly suitable for initial characterization studies and can be optimized with:

    • Inducible promoters (T7, araBAD)

    • Fusion tags for detection and purification (His6, MBP, GST)

    • Codon optimization if rare codons are present in the crcB sequence

  • Membrane protein-specific expression systems: Since CrcB is a membrane protein, specialized expression systems that facilitate proper membrane integration should be considered:

    • C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression

    • Cell-free expression systems with lipid nanodiscs or detergent micelles

    • Insect cell expression systems (baculovirus) for eukaryotic membrane protein machinery

  • Native expression system: For functional studies, expression in an attenuated S. dysenteriae strain might be considered, potentially using techniques similar to those employed in proteome studies of S. dysenteriae under various conditions .

When designing expression constructs, researchers should account for the predicted membrane topology of CrcB and consider including solubilizing fusion partners if necessary. Expression levels should be monitored and optimized through techniques such as Western blotting, as has been done with other S. dysenteriae proteins detected as antigens in Western blots using piglet antisera .

What are the optimal conditions for purifying recombinant CrcB protein?

Purification of recombinant CrcB homolog from S. dysenteriae requires specialized approaches due to its membrane protein nature:

  • Membrane extraction:

    • Isolate membrane fractions using ultracentrifugation techniques similar to those used in membrane fraction analysis of Shigella proteome studies

    • Use mild detergents for solubilization (DDM, LMNG, or Triton X-100)

    • Screen multiple detergents at different concentrations (0.5-2% typically) to optimize extraction while maintaining protein integrity

  • Affinity chromatography:

    • Utilize fusion tags (His6, FLAG, or Strep) for initial capture

    • Implement gradual detergent reduction during purification to maintain stability

    • Consider adding stabilizing agents like glycerol (10-15%) and specific lipids

  • Size exclusion chromatography:

    • Employ as a final purification step to isolate homogeneous CrcB oligomers

    • Use buffers containing low detergent concentrations (0.03-0.05% typically)

    • Consider buffer components that mimic bacterial membrane environment

  • Quality control:

    • Verify protein purity through SDS-PAGE and Western blotting

    • Confirm identity through mass spectrometry, similar to proteome analysis techniques used for S. dysenteriae protein identification

    • Assess oligomeric state through native PAGE or analytical ultracentrifugation

The purification protocol should be optimized based on protein stability analyses, as membrane proteins often require specific detergent and lipid environments to maintain their native conformation. Temperature control (typically 4°C throughout purification) and protease inhibitors should be employed to prevent degradation, particularly important when working with proteins from pathogenic bacteria like S. dysenteriae.

What role might CrcB play in Shigella dysenteriae pathogenesis?

While direct evidence linking CrcB to S. dysenteriae pathogenesis is not explicitly mentioned in the provided search results, we can formulate hypotheses based on bacterial physiology and pathogen survival mechanisms:

  • Acid stress response: S. dysenteriae must survive the acidic environment of the human gastrointestinal tract. Proteomic studies have shown that S. dysenteriae employs acid stress response proteins including GadB, AdiA, HdeA, HdeB, and ClpB when isolated from infected hosts . CrcB may contribute to pH homeostasis by preventing accumulation of fluoride ions, which can exacerbate acid stress by dissociating into HF and crossing membranes.

  • Environmental adaptation: Differential display analysis has revealed that S. dysenteriae cells switch to anaerobic energy metabolism in vivo . CrcB could play a role in adaptation to the host environment by helping maintain ion homeostasis under changing conditions.

  • Survival in water sources: As S. dysenteriae can survive in contaminated food and water , CrcB may contribute to survival in environments containing naturally occurring fluoride.

  • Interaction with host factors: While type III secretion system (T3SS) effectors like OspF, IpaC, and IpaD have been implicated in invasion of colonocytes and subversion of host immune responses , membrane proteins including channels and transporters could indirectly support these virulence mechanisms by maintaining bacterial cellular homeostasis.

To investigate CrcB's role in pathogenesis, researchers could generate crcB deletion mutants and assess their virulence in established animal models like the gnotobiotic piglet model used for proteome analysis or the cynomolgus macaque challenge model . Changes in bacterial survival, colonization, and host immune response could indicate CrcB's contribution to pathogenesis.

How does the CrcB homolog in Shigella dysenteriae compare to other bacterial species?

A comparative analysis of the CrcB homolog across bacterial species reveals important insights about evolutionary conservation and potential functional specialization:

  • Genomic context comparison:

    • The CrcB homolog in S. dysenteriae would likely be located in the ~3 Mb genetic backbone shared among Shigella and E. coli genomes

    • Unlike some virulence factors that are plasmid-encoded, CrcB is chromosomally encoded as part of the core genome

    • Comparison with other Shigella species (S. boydii, S. flexneri, S. sonnei) whose genomes have been sequenced would reveal conservation levels within the genus

  • Sequence conservation analysis:

    • Multiple sequence alignment would likely show high conservation in transmembrane domains and fluoride ion binding sites

    • Species-specific variations might exist in regulatory regions or loop domains

    • Phylogenetic analysis could place S. dysenteriae CrcB in relation to other enteric pathogens

  • Structural and functional prediction:

    • Homology modeling based on solved CrcB structures from other bacteria could predict structural features unique to S. dysenteriae

    • Functional domains can be identified through comparison with characterized CrcB proteins using tools employed in the genome annotation of S. dysenteriae strains

A detailed comparative analysis table could be constructed using genomic data from the sequenced S. dysenteriae strains (Sd1617, Sd197) and other Shigella species, examining sequence identity percentages, conserved domains, and genomic neighborhood. This comparison would provide insights into whether the S. dysenteriae CrcB has unique features that might be related to its specific pathogenic lifestyle or environmental adaptation strategies.

What experimental approaches are most effective for studying CrcB function in vivo?

Investigating CrcB function in the context of living S. dysenteriae requires sophisticated experimental approaches:

  • Gene knockout and complementation studies:

    • Generate crcB deletion mutants in S. dysenteriae using techniques like λ Red recombineering

    • Create complementation strains expressing wild-type crcB from controlled promoters

    • Compare growth in media containing varying fluoride concentrations

    • Assess survival under acid stress conditions, mimicking gastrointestinal environments

  • Animal infection models:

    • Utilize established animal models for S. dysenteriae infection:

      • Gnotobiotic piglet model that has been used for proteome analysis of in vivo bacterial adaptations

      • Cynomolgus macaque challenge model developed for studying S. dysenteriae pathogenesis

    • Compare colonization efficiency, tissue distribution, and disease progression between wild-type and crcB mutant strains

    • Analyze bacterial protein expression patterns in vivo as has been done for other S. dysenteriae proteins

  • Fluorescence-based assays:

    • Develop fluoride-sensitive fluorescent reporters for tracking ion flux

    • Use fluorescently-tagged CrcB to track protein localization during infection

    • Implement FRET-based approaches to identify potential interaction partners

  • Transcriptomic and proteomic analyses:

    • Compare gene expression profiles between wild-type and crcB mutants under various conditions

    • Apply differential proteome display analysis similar to that used to identify proteins with altered abundance during in vivo growth

    • Identify compensatory mechanisms activated in the absence of functional CrcB

These methodologies would enable researchers to establish the importance of CrcB in S. dysenteriae survival and pathogenesis, particularly in the context of acid stress response and adaptation to the host environment, which have been shown to be key aspects of S. dysenteriae in vivo behavior .

How can I design experiments to study CrcB's role in fluoride resistance in Shigella dysenteriae?

To investigate CrcB's role in fluoride resistance in S. dysenteriae, a comprehensive experimental approach should include:

  • Minimum inhibitory concentration (MIC) determination:

    • Measure growth inhibition of wild-type S. dysenteriae in media containing increasing fluoride concentrations (typically 0.5-20 mM NaF)

    • Compare with crcB deletion mutants and complemented strains

    • Evaluate MICs under various pH conditions (5.0-7.5) to assess the role of HF formation

    • Examine growth kinetics through time-course measurements rather than endpoint readings

  • Fluoride uptake and efflux assays:

    • Utilize fluoride-specific electrodes to measure extracellular fluoride concentrations

    • Employ radioactive ^18F to track fluoride movement across bacterial membranes

    • Compare fluoride accumulation in wild-type versus crcB mutant S. dysenteriae cells

    • Develop real-time fluoride sensing using fluorescent indicators

  • Transcriptional response analysis:

    • Perform RNA-Seq to identify genes differentially expressed in response to fluoride exposure

    • Characterize the crcB promoter region and potential regulatory elements

    • Investigate whether crcB is co-regulated with other stress response genes identified in S. dysenteriae proteome studies

    • Use reporter gene fusions to monitor crcB expression under various conditions

  • Physiological impact assessment:

    • Measure internal pH in wild-type versus crcB mutant strains during fluoride exposure

    • Evaluate the effect of fluoride on key metabolic pathways identified in S. dysenteriae

    • Assess membrane potential alterations using voltage-sensitive dyes

    • Examine changes in ATP production and energy metabolism, which has been shown to adapt during in vivo growth

  • Comparative analysis across Shigella species:

    • Compare fluoride resistance profiles among different Shigella species whose genomes have been sequenced (S. dysenteriae, S. flexneri, S. boydii, S. sonnei)

    • Correlate resistance with CrcB sequence variations or expression levels

Results from these experiments would produce a comprehensive profile of fluoride resistance mechanisms in S. dysenteriae and establish the specific contribution of CrcB to this aspect of bacterial physiology.

What structural biology techniques are most suitable for CrcB characterization?

Characterizing the structure of the S. dysenteriae CrcB homolog requires specialized approaches for membrane proteins:

  • X-ray crystallography:

    • Challenges: Membrane proteins are difficult to crystallize due to their hydrophobic surfaces

    • Optimization strategies:

      • Utilize fusion partners that facilitate crystallization (e.g., T4 lysozyme)

      • Screen multiple detergents and lipidic cubic phase methods

      • Implement surface entropy reduction mutations

    • Expected resolution: 2.0-3.5 Å for well-diffracting crystals

  • Cryo-electron microscopy (Cryo-EM):

    • Increasingly popular for membrane proteins like CrcB

    • Sample preparation options:

      • Detergent micelles (0.1-0.5% critical concentration)

      • Nanodiscs with MSP1D1 scaffold proteins

      • Amphipols or SMALPs for native-like membrane environments

    • Resolution potential: 2.5-4.0 Å for medium-sized membrane proteins like CrcB

  • Nuclear Magnetic Resonance (NMR):

    • Suitable for dynamic studies of CrcB:

      • ^15N/^13C labeling required for heteronuclear experiments

      • Detergent selection critical (typically DPC or LPPG)

      • Solution NMR for smaller fragments, solid-state NMR for intact protein

    • Information obtainable: Dynamics, ligand binding, conformational changes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Valuable for mapping solvent-accessible regions and conformational changes

    • Can identify fluoride binding sites and regions that undergo structural transitions

    • Requires less protein than crystallography or Cryo-EM

  • Molecular dynamics simulations:

    • Complement experimental approaches with computational modeling

    • Simulate fluoride transport through the channel

    • Predict effects of mutations identified in comparative genomic analyses

Each method provides different information, and an integrated structural biology approach would yield the most comprehensive understanding of CrcB structure-function relationships. The techniques could be applied to address specific questions about fluoride selectivity, transport mechanism, and structural adaptations unique to S. dysenteriae.

How can I develop specific antibodies against the Shigella dysenteriae CrcB protein?

Developing specific antibodies against the S. dysenteriae CrcB protein requires careful consideration of its membrane protein nature:

  • Antigen design strategies:

    • Full-length protein approach:

      • Express and purify the complete CrcB protein in detergent micelles

      • Challenge: Maintaining native conformation during immunization

    • Peptide-based approach:

      • Identify hydrophilic loops exposed to the extracellular or cytoplasmic space

      • Select 15-20 amino acid peptides with high predicted antigenicity

      • Conjugate to carrier proteins (KLH or BSA) to enhance immunogenicity

    • Recombinant domain approach:

      • Express soluble domains of CrcB as fusion proteins

      • Select regions unique to S. dysenteriae CrcB based on sequence comparisons

  • Immunization protocol optimization:

    • Animal selection: Rabbits for polyclonal antibodies, mice for monoclonal development

    • Adjuvant selection: Critical for membrane proteins (Freund's, RIBI, or alum)

    • Immunization schedule: Extended protocols often needed for weak antigens

    • Booster design: Alternating between different antigen preparations

  • Antibody purification and validation:

    • Affinity purification against the immunizing antigen

    • Negative selection against homologous proteins from related bacteria

    • Validation methods:

      • Western blotting of recombinant CrcB and native protein from S. dysenteriae lysates

      • Immunofluorescence microscopy to confirm cellular localization

      • Flow cytometry for quantitative binding assessment

      • Epitope mapping to confirm specificity

  • Cross-reactivity testing:

    • Test against extracts from multiple Shigella species to assess specificity

    • Evaluate potential cross-reactivity with E. coli homologs due to the genetic similarity

    • Confirm specificity using crcB knockout strains as negative controls

Successful antibody development would provide valuable tools for studying CrcB expression, localization, and potential modifications under different environmental conditions, similar to immunogenicity studies conducted with other S. dysenteriae proteins .

What approaches can be used to study CrcB membrane topology in Shigella dysenteriae?

Determining the membrane topology of CrcB in S. dysenteriae requires complementary experimental approaches:

  • Computational prediction methods:

    • Hydropathy analysis using algorithms like TMHMM, Phobius, or TOPCONS

    • Integration of evolutionary conservation data from multiple CrcB homologs

    • Signal sequence and charge distribution analysis to predict orientation

    • Creation of topology models that can be experimentally validated

  • Reporter fusion approaches:

    • PhoA/LacZ fusion strategy:

      • Create systematic fusions of CrcB fragments with alkaline phosphatase (PhoA) and β-galactosidase (LacZ)

      • PhoA is active only when located in the periplasm, while LacZ functions in the cytoplasm

      • Sequential truncations reveal topology by activity patterns

    • GFP-based methods:

      • Exploit the fact that GFP fluoresces in the cytoplasm but not the periplasm

      • Create systematic C-terminal truncation-GFP fusions

      • Fluorescence patterns reveal cytoplasmic regions

  • Cysteine accessibility methods:

    • Substituted cysteine accessibility method (SCAM):

      • Replace native cysteines with alanines, then introduce single cysteines at various positions

      • Treat intact cells with membrane-impermeable sulfhydryl reagents

      • Accessible cysteines indicate extracellular/periplasmic locations

    • Pegylation assays:

      • Use maleimide-PEG to modify accessible cysteines

      • Detect mobility shifts in SDS-PAGE

  • Protease protection assays:

    • Prepare inside-out and right-side-out membrane vesicles

    • Treat with proteases (trypsin, proteinase K)

    • Identify protected fragments by Western blotting

    • Mass spectrometry to identify cleavage sites

  • Antibody accessibility:

    • Generate antibodies against specific domains predicted to be extracellular or cytoplasmic

    • Test accessibility in intact cells versus permeabilized cells

    • Immunofluorescence microscopy to visualize binding patterns

These approaches would generate a comprehensive topology model of CrcB in S. dysenteriae, which is essential for understanding its function as a fluoride channel and potential interactions with other membrane components or host factors during infection.

How can genomic data be used to analyze CrcB conservation across Shigella dysenteriae strains?

Genomic analysis of CrcB conservation requires systematic bioinformatic approaches applied to available S. dysenteriae genome sequences:

  • Comparative genomic analysis:

    • Identify the crcB gene in sequenced S. dysenteriae genomes including Sd197 and Sd1617

    • Extract sequences using annotation data from genome repositories

    • Perform multiple sequence alignment to identify:

      • Core conserved regions (likely functional domains)

      • Variable regions (potentially adaptive)

      • Single nucleotide polymorphisms (SNPs)

  • Conservation metrics:

    • Calculate sequence identity percentages across strains

    • Determine synonymous/non-synonymous substitution ratios (dN/dS) to assess selective pressure

    • Analyze codon usage patterns to identify potential expression level differences

  • Genomic context analysis:

    • Examine gene neighborhood conservation around crcB

    • Identify potential operonic structures and co-regulated genes

    • Compare with the genomic organization in other Shigella species and E. coli

StrainAccessionCrcB Sequence IdentityGenomic Context ConservationEvidence of Selection (dN/dS)
Sd197CP000034ReferenceReferenceN/A
Sd1617-To be determinedTo be determinedTo be determined
Other strainsVariousTo be determinedTo be determinedTo be determined

What role might CrcB play in bacterial stress responses based on proteomic data?

Although CrcB is not specifically mentioned in the provided proteomic analysis of S. dysenteriae, its potential role in stress responses can be inferred based on known fluoride channel functions and observed bacterial adaptations:

  • Integration with known stress responses:

    • Proteomic studies of S. dysenteriae identified multiple stress response proteins upregulated in vivo, including acid stress response proteins (GadB, AdiA) and protein disaggregation chaperones (HdeA, HdeB, ClpB)

    • As a fluoride channel, CrcB likely functions alongside these proteins in maintaining cellular homeostasis

    • CrcB may contribute to pH homeostasis by preventing fluoride-induced disruption of proton gradients

  • Adaptive response mechanisms:

    • S. dysenteriae cells switch to anaerobic energy metabolism in vivo

    • This metabolic adaptation suggests coordinated stress responses in which ion transport proteins like CrcB may play supporting roles

    • The bacterial survival response likely integrates multiple mechanisms including pH homeostasis, in which CrcB could participate

  • Potential co-regulation patterns:

    • Analysis of transcriptional regulatory networks could reveal whether crcB is co-regulated with known stress response genes

    • Patterns of protein abundance changes under different conditions could suggest functional relationships

  • Experimental validation approaches:

    • Proteomic profiling of wild-type versus crcB mutant strains under stress conditions

    • Comparative analysis of stress protein expression in the presence of fluoride

    • Investigation of potential protein-protein interactions between CrcB and identified stress response proteins

By integrating CrcB into the broader context of S. dysenteriae stress responses observed in proteomic studies, researchers can develop hypotheses about its role in bacterial adaptation to host environments and guide future experimental investigations.

What are the most promising directions for CrcB research in Shigella dysenteriae?

The study of CrcB homolog in S. dysenteriae offers several promising research directions with significant implications for understanding bacterial pathogenesis and developing novel therapeutic approaches:

  • Pathogenesis mechanisms:

    • Investigate whether CrcB contributes to S. dysenteriae survival in the acidic environment of the gastrointestinal tract

    • Determine if CrcB function influences expression or activity of known virulence factors such as the type III secretion system effectors identified in proteomic studies

    • Explore potential connections between fluoride homeostasis and bacterial adaptation to the host environment, where S. dysenteriae has been shown to switch to anaerobic metabolism

  • Antimicrobial development:

    • Evaluate CrcB as a potential drug target, similar to other membrane proteins identified in S. dysenteriae that represent novel subunit vaccine candidates and drug targets

    • Design small molecule inhibitors that could disrupt fluoride export and enhance fluoride toxicity

    • Investigate whether CrcB inhibition could potentiate existing antibiotics by disrupting bacterial homeostasis

  • Structural biology advances:

    • Determine high-resolution structures of S. dysenteriae CrcB to identify unique features compared to homologs in other bacteria

    • Characterize the fluoride binding and transport mechanism through structural studies

    • Investigate potential structural adaptation of CrcB in the context of S. dysenteriae's lifestyle as an intracellular pathogen

  • Systems biology integration:

    • Place CrcB function in the broader context of S. dysenteriae metabolic networks and stress responses

    • Develop predictive models of how CrcB activity influences bacterial fitness under different environmental conditions

    • Integrate genomic, transcriptomic, and proteomic data to understand CrcB regulation and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.