Recombinant Shigella dysenteriae serotype 1 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Proteolytic Activity

GlpG mediates intramembrane proteolysis, targeting orphan subunits of membrane protein complexes for degradation. Substrates include:

SubstrateFunctionCleavage Efficiency
HybA/HybO (Hyd-2 complex)Hydrogenase-2 subunitHigh (GlpG-dependent)
FdoHFormate dehydrogenase subunitModerate
YqjDRibosome-associated proteinLow

Source:

GlpG initiates proteolysis by forming an "interrogation complex" with substrates, followed by irreversible cleavage .

Vaccine Development

While GlpG itself is not a vaccine component, Shigella-derived proteins like O-antigens are used in glycoconjugate vaccines . Recombinant GlpG is employed in:

  • Quality control studies of membrane proteins .

  • Enzymatic assays to investigate intramembrane proteolysis mechanisms .

Experimental Findings

  • Deletion of glpG and rhom7 in Shigella sonnei did not impair growth under aerobic/anaerobic conditions or oxidative stress resistance .

  • GlpG’s activity is substrate-specific, preferring TMDs with metastable structural features .

Production and Stability

Recombinant GlpG is produced in E. coli systems and purified to >85% purity (SDS-PAGE) . Key storage parameters:

ParameterSpecification
Storage Temperature-20°C/-80°C (lyophilized or liquid)
Shelf Life6–12 months
ReconstitutionTris/PBS buffer with 5–50% glycerol

Evolutionary and Pathogenic Context

GlpG homologs are conserved across Shigella species (S. flexneri, S. boydii) and related pathogens like Salmonella . In S. dysenteriae, GlpG is chromosomally encoded, adjacent to glpE (involved in sulfur metabolism) . Its role in virulence remains unclear, as knockout strains retain infectivity in model systems .

Limitations and Future Directions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to concentrate the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; SDY_3651; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPALKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: sdy:SDY_3651

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the rhomboid protease GlpG in Shigella dysenteriae serotype 1?

GlpG is an intramembrane serine protease belonging to the rhomboid family found in Shigella dysenteriae serotype 1. In Shigella sonnei, a close relative of S. dysenteriae, GlpG shares 99% amino acid identity with the prototypical rhomboid of Escherichia coli . The protease contains a catalytic dyad (Ser201/His254) embedded approximately 10 Å below the membrane surface, which is crucial for its proteolytic activity . GlpG functions primarily in membrane protein quality control by specifically targeting components of respiratory complexes, recognizing and cleaving metastable transmembrane domains (TMDs) of unincorporated protein complex components .

How does GlpG identify and process its substrates?

GlpG identifies substrates through recognition of their transmembrane domains (TMDs). The current model indicates that rhomboid-mediated proteolysis is a rate-driven process, with the affinity of the enzyme for its substrate playing a less significant role . The process begins with the formation of an "interrogation complex" when the TMD of a substrate engages with GlpG's accessible catalytic site .

Substrate processing follows these stages:

  • Initial recognition of metastable TMDs that are not incorporated into functional complexes

  • Formation of the interrogation complex

  • Proteolytic cleavage by the catalytic dyad

  • Subsequent degradation of the orphan substrate

The protease specifically targets orphan components of protein complexes, with the TMDs of rhomboid substrates protected when incorporated into functional complexes .

What are the known substrates of Shigella GlpG?

Research has identified several validated substrates of GlpG in Shigella sonnei, which likely apply to S. dysenteriae as well given their close relationship:

  • HybA - a subunit of the hydrogenase-2 complex (Hyd-2)

  • HybO - another subunit of the hydrogenase-2 complex

  • FdoH - a subunit of the formate dehydrogenase O complex

  • YqjD - a ribosome-associated protein

These substrates were confirmed through experiments comparing cleavage patterns of substrate TMDs in the presence of active versus inactive (S201A mutant) versions of the protease .

How does GlpG compare to other rhomboid proteases in Shigella?

Shigella sonnei (and likely S. dysenteriae) possesses at least two rhomboid proteases:

Rhomboid ProteaseStructural FeaturesKey SubstratesFunction
GlpGSimilar to E. coli GlpG (99% identity)HybA, HybO, FdoH, YqjDQuality control of orphan respiratory complex components
Rhom7Predicted to possess seven TMDsHybA, FdnHSimilar role in quality control

While there is some overlap in substrate specificity (both cleave HybA), they also display distinct preferences, with GlpG targeting FdoH and Rhom7 targeting FdnH . This suggests complementary but non-redundant roles in membrane protein quality control.

What methodologies are most effective for characterizing GlpG activity in vitro?

For effective characterization of GlpG activity in vitro, researchers should employ a multi-faceted approach:

  • Recombinant expression and purification: Express GlpG with appropriate tags in E. coli systems. The use of E. coli K-12 W3110 strain has proven effective for recombinant expression of Shigella proteins .

  • Site-directed mutagenesis: Generate catalytically inactive variants (e.g., S201A) to serve as negative controls and confirm proteolytic activity .

  • In vitro cleavage assays:

    • Use synthetic peptides containing the transmembrane domains of known substrates

    • Employ fluorescence-based methods to monitor cleavage efficiency

    • Analyze products by SDS-PAGE, western blotting, and mass spectrometry

  • Activity validation: Compare cleavage patterns between active and catalytically inactive versions of the protease to confirm specificity .

  • Structural analysis: Techniques like X-ray crystallography or cryo-EM can provide insights into the structural basis of substrate recognition and cleavage.

How can researchers establish a reliable recombinant expression system for S. dysenteriae GlpG?

To establish a reliable recombinant expression system for S. dysenteriae GlpG, researchers should consider the following approach:

  • Gene optimization and vector selection:

    • Optimize the coding sequence for the expression host

    • Select vectors with tight regulatory control (e.g., arabinose-inducible pBAD or IPTG-inducible pET systems)

    • Include appropriate affinity tags (His6, FLAG, etc.) for purification

  • Expression host selection:

    • E. coli K-12 W3110 has been successfully used for heterologous expression of S. dysenteriae proteins

    • Consider membrane protein-optimized strains like C41(DE3) or C43(DE3)

  • Expression conditions optimization:

    • Test various induction parameters (temperature, inducer concentration, duration)

    • Optimize growth media composition

    • Consider using lower temperatures (16-20°C) for better folding of membrane proteins

  • Membrane preparation and solubilization:

    • Use gentle detergents like DDM, LMNG, or GDN for extraction

    • Perform detergent screening to identify optimal solubilization conditions

  • Purification strategy:

    • Implement a multi-step purification procedure

    • Consider size exclusion chromatography as a final step to ensure homogeneity

  • Activity verification:

    • Compare with wild-type and inactive mutant (S201A) controls

    • Validate using known substrates like HybA, FdoH, or synthetic peptides containing their TMDs

What experimental approaches can reveal the molecular mechanism of GlpG in membrane protein quality control?

To elucidate the molecular mechanism of GlpG in membrane protein quality control, researchers should consider these experimental approaches:

  • Substrate identification and validation:

    • Implement proteomics approaches comparing wild-type and GlpG-deficient strains

    • Validate candidates using in vitro cleavage assays with purified components

    • Conduct site-directed mutagenesis of substrate TMDs to identify recognition motifs

  • Structure-function analysis:

    • Generate a panel of GlpG variants with mutations in key regions

    • Assess their ability to recognize and cleave specific substrates

    • Use structural biology techniques (X-ray crystallography, cryo-EM) to visualize enzyme-substrate interactions

  • In vivo assays:

    • Create reporter systems to monitor substrate degradation in real-time

    • Develop assays to measure accumulation of uncleaved substrates in membranes

    • Use fluorescence microscopy to track localization of GlpG and its substrates

  • Reconstitution systems:

    • Reconstitute GlpG and its substrates in artificial membrane systems

    • Assess the impact of membrane composition on activity

    • Measure kinetic parameters of substrate cleavage

  • Interaction network mapping:

    • Identify proteins that interact with GlpG using techniques like BioID or proximity labeling

    • Determine if GlpG functions in concert with other quality control machinery

How does the substrate specificity of S. dysenteriae GlpG differ from other bacterial rhomboid proteases?

Understanding the substrate specificity of S. dysenteriae GlpG compared to other bacterial rhomboid proteases requires detailed comparative analysis:

  • Substrate profiling:

    • Perform systematic screening of potential substrates against multiple rhomboid proteases

    • Compare the substrate repertoire of S. dysenteriae GlpG with E. coli GlpG (99% identity) and Rhom7

    • Analyze the TMDs of identified substrates to detect conserved recognition motifs

  • Cross-species complementation:

    • Test if S. dysenteriae GlpG can complement the function of rhomboid proteases in other species

    • Examine if expressing GlpG in ΔglpG strains of E. coli or other bacteria restores normal phenotypes

  • Chimeric protein analysis:

    • Create chimeric proteins by swapping domains between GlpG and other rhomboid proteases

    • Identify regions responsible for substrate specificity differences

  • Comparative structural analysis:

    • Compare the structures of the substrate-binding pockets of different rhomboid proteases

    • Identify key residues that might confer specific substrate preferences

Current data suggests that S. dysenteriae GlpG specifically targets components of respiratory complexes (HybA, HybO, FdoH, YqjD), which indicates a specialized role in quality control of respiratory machinery .

What is the potential significance of studying GlpG for understanding Shigella pathogenesis?

Studying GlpG has several important implications for understanding Shigella pathogenesis:

  • Metabolic adaptation during infection:

    • GlpG targets components of respiratory complexes, suggesting a role in regulating energy metabolism

    • This may be critical for Shigella's adaptation to changing environments during infection

    • S. dysenteriae colonizes the anaerobic environment of the large intestine, where respiratory complex regulation is crucial

  • Membrane integrity and stress responses:

    • Proper quality control of membrane proteins is essential for bacterial survival under stress conditions

    • Defects in this process might affect the bacterium's ability to withstand host defense mechanisms

  • Potential therapeutic target:

    • Understanding GlpG function could reveal new vulnerabilities for targeted antimicrobial development

    • This is particularly important given the high level of antimicrobial resistance in Shigella species

  • Interaction with host cells:

    • Membrane protein quality control may influence the expression of virulence factors

    • While current evidence doesn't show direct impacts on the type three secretion system essential for Shigella virulence, more subtle effects may exist

How can GlpG research contribute to vaccine development strategies against Shigella?

GlpG research may contribute to vaccine development strategies in several ways:

  • Antigen production and quality:

    • Understanding GlpG's role in membrane protein quality control could improve production of recombinant membrane antigens for vaccines

    • This knowledge may enhance the development of heterologous expression systems like those used for O-polysaccharide production in E. coli

  • Novel antigen identification:

    • GlpG-regulated proteins might represent new antigenic targets for vaccine development

    • Proteins that accumulate in ΔglpG strains could be evaluated as potential immunogens

  • Attenuated vaccine strains:

    • GlpG-deficient Shigella strains could potentially serve as attenuated live vaccine candidates if the mutation affects fitness without eliminating immunogenicity

    • Such strains might present a modified antigen profile that enhances protective immunity

  • Glycoconjugate vaccine optimization:

    • Current glycoconjugate vaccine approaches for Shigella use various protein carriers

    • Understanding how GlpG affects membrane protein stability could inform selection of optimal protein carriers or expression systems

Glycan Source and Vaccine CategoryVaccine CandidatePhase of Development
Detoxified LPS: "lattice"-type conjugateSD1 dLPS-TT pmLPS-TTPhase I
SF2apmLPS-rEPA succPhase I
pmLPS-CRM9Phase I
pmLPS-CRM9 succPhase I
pmLPS-rEPAPhase III
pmLPS-CfaEBPhase I
S. sonneipmLPS-rEPA succPhase I
pmLPS-CRM9 pmLPS-CRM9 succPhase I
pmLPS-rEPAPhase III

Table adapted from search result , showing various Shigella vaccine candidates in development

What are the key technical challenges in purifying active recombinant GlpG and how can they be addressed?

Purifying active recombinant GlpG presents several technical challenges:

  • Membrane protein solubilization:

    • Challenge: Extracting GlpG from membranes while maintaining its native structure and activity

    • Solution: Screen multiple detergents and lipid-like substances (nanodisc, SMALPs, amphipols) to identify optimal solubilization conditions

    • Recommendation: Start with mild detergents like DDM, LMNG, or GDN that have proven successful for other rhomboid proteases

  • Expression levels and toxicity:

    • Challenge: Overexpression of membrane proteases can be toxic to host cells

    • Solution: Use tightly regulated inducible expression systems and optimize induction parameters

    • Recommendation: Test expression in E. coli K-12 W3110, which has been successfully used for recombinant expression of S. dysenteriae proteins

  • Protein stability and activity retention:

    • Challenge: Maintaining proteolytic activity throughout purification

    • Solution: Include stabilizing agents (glycerol, specific lipids) in purification buffers

    • Recommendation: Monitor activity at each purification step using synthetic peptide substrates

  • Heterogeneity and aggregation:

    • Challenge: Preventing oligomerization and aggregation

    • Solution: Implement size exclusion chromatography as a final purification step

    • Recommendation: Consider using fusion partners that enhance solubility

  • Functional validation:

    • Challenge: Confirming that purified GlpG retains native substrate specificity

    • Solution: Compare activity against known substrates (HybA, FdoH) with that of native GlpG

    • Recommendation: Include inactive mutant (S201A) as a negative control

What emerging technologies could advance our understanding of GlpG function?

Several emerging technologies hold promise for advancing our understanding of GlpG function:

  • Cryo-electron microscopy (cryo-EM):

    • Allows visualization of GlpG-substrate complexes in near-native states

    • Can capture different conformational states during the proteolytic process

    • May reveal detailed mechanisms of substrate recognition and processing

  • Native mass spectrometry:

    • Enables analysis of intact membrane protein complexes

    • Can identify transient interactions between GlpG and its substrates or regulatory partners

    • Useful for studying the dynamics of substrate binding and release

  • Single-molecule techniques:

    • FRET-based approaches to monitor GlpG-substrate interactions in real-time

    • Single-molecule force spectroscopy to measure the energetics of substrate binding

    • May reveal heterogeneity in GlpG behavior not apparent in bulk measurements

  • Genome-wide CRISPR screens:

    • Identify genetic interactions that modify GlpG function

    • Discover new pathways connected to GlpG-mediated quality control

    • May reveal synthetic lethalities that could inform antimicrobial strategies

  • Artificial intelligence for structure prediction:

    • Tools like AlphaFold2 can predict structures of GlpG-substrate complexes

    • May help identify critical interaction interfaces

    • Could guide rational design of inhibitors or substrate mimetics

How might comparative studies across different Shigella species enhance our understanding of GlpG function?

Comparative studies across different Shigella species could provide valuable insights:

  • Evolutionary analysis:

    • Compare GlpG sequences across Shigella species and related Enterobacteriaceae

    • Identify conserved regions that likely represent functional domains

    • Detect species-specific variations that might relate to pathogenic differences

  • Substrate repertoire comparison:

    • Determine if GlpG targets the same substrates across different Shigella species

    • Identify species-specific substrates that might contribute to unique virulence traits

    • Compare substrate recognition motifs across species

  • Functional complementation tests:

    • Examine if GlpG from one Shigella species can complement deficiencies in another

    • Identify species-specific functional requirements

    • Create chimeric GlpG proteins to map functional domains

  • Pathogenesis model studies:

    • Compare the impact of GlpG deletion on virulence across different Shigella species

    • Correlate differences in GlpG function with specific pathogenic mechanisms

    • Utilize the Shigella human challenge model to assess in vivo relevance

  • Host-pathogen interaction analysis:

    • Investigate if GlpG influences host-pathogen interactions differently across Shigella species

    • Examine potential effects on immune recognition and evasion strategies

    • Study implications for vaccine development targeting multiple species

What are the most significant recent advances in understanding GlpG function?

The most significant recent advances in understanding GlpG function include:

  • The discovery that rhomboid proteases like GlpG mediate quality control of orphan membrane proteins, specifically targeting components of respiratory complexes that aren't incorporated into functional complexes .

  • Identification of specific substrates in Shigella, including HybA, HybO, FdoH, and YqjD, providing concrete evidence of GlpG's role in regulating respiratory complex assembly .

  • Recognition that the metastable transmembrane domains of rhomboid substrates are protected when they are incorporated into functional complexes, explaining the specificity for orphan components .

  • The finding that initial cleavage by GlpG allows subsequent degradation of the orphan substrate, establishing its role as an initiator in a larger quality control pathway .

  • The demonstration that this quality control mechanism is conserved across evolutionary ancient organisms, suggesting its fundamental importance in cellular function .

These advances collectively establish GlpG as a critical component of membrane protein quality control systems in bacteria, with potential implications for understanding similar processes in eukaryotes and developing new therapeutic strategies against bacterial pathogens like Shigella dysenteriae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.