Recombinant Shigella dysenteriae serotype 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ugpA; SDY_3600; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
ugpA
Target Protein Sequence
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV ALFHDSYYIDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA LQSIPRSLIEAAAIDGVGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG GPVQAITTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: sdy:SDY_3600

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of ugpA in Shigella dysenteriae?

The ugpA protein functions as a permease component of the sn-glycerol-3-phosphate transport system in Shigella dysenteriae serotype 1. This system facilitates the uptake of glycerol-3-phosphate, which serves as an important carbon and phosphate source for bacterial metabolism. The transport system is particularly critical when Shigella navigates through different environments within the human body, including the stomach and intestines, where nutrient availability varies significantly . The ugpA protein (amino acids 1-295) works in conjunction with other components of the transport system, including ugpE, to enable substrate translocation across the bacterial membrane .

How can researchers effectively express recombinant ugpA protein?

Recombinant ugpA protein can be expressed using several expression systems. According to available research data, the protein can be produced in E. coli, yeast, baculovirus, or mammalian cell expression systems . The selection of an appropriate system depends on experimental requirements:

Expression SystemAdvantagesChallengesRecommended for
E. coliHigh yield, rapid growth, cost-effectivePotential inclusion body formation, limited post-translational modificationsStructural studies, antibody production
YeastPost-translational modifications, moderate yieldLonger production time, different codon usageFunctional studies requiring glycosylation
BaculovirusHigher-order post-translational modifications, proper foldingTechnical complexity, higher costComplex functional assays, protein-protein interaction studies
Mammalian cellsNative-like folding and modificationsHighest cost, lowest yield, technical expertise requiredStudies requiring mammalian-specific modifications

For purification of recombinant ugpA, a histidine-tag approach is commonly employed, followed by immobilized metal affinity chromatography (IMAC) and subsequent size exclusion chromatography to achieve high purity.

What detection methods are suitable for ugpA protein in experimental systems?

Detection of ugpA can be accomplished through several methods, similar to those used for other Shigella proteins. Immunoassays such as ELISA or multiplexed technologies (Luminex) offer high-throughput options for detection and quantification . For multiplexed detection approaches, researchers have successfully developed panels that can simultaneously detect multiple Shigella antigens. When designing detection systems, it's advisable to include appropriate controls such as IpaB, IpaC, and IpaD, which have been successfully incorporated into multiplex panels alongside other Shigella antigens .

How does ugpA contribute to Shigella dysenteriae pathogenesis?

While direct evidence specifically linking ugpA to pathogenesis is limited in the search results, we can analyze its potential role based on Shigella infection mechanisms. As a nutrient transport protein, ugpA likely contributes to bacterial fitness during infection by enabling efficient nutrient acquisition. Shigella dysenteriae serotype 1 invades the colonic epithelium to cause disease, and this invasion process requires metabolic adaptation to different host environments .

The bacterial second messenger cyclic di-GMP (c-di-GMP) signaling system plays a crucial role in this adaptation process. This system, synthesized by diguanylate cyclases (DGCs) encoding GGDEF domains, influences various bacterial behaviors . Although not directly stated in the search results, transport proteins like ugpA may be regulated by such signaling systems to optimize nutrient uptake during different phases of infection. Researchers investigating this relationship should consider:

  • Examining ugpA expression levels under conditions mimicking different host environments

  • Studying potential regulatory mechanisms connecting c-di-GMP signaling to ugpA function

  • Evaluating the impact of ugpA mutations on bacterial colonization capabilities

What methodological approaches can be used to study ugpA function in infection models?

To study ugpA function in infection contexts, researchers can employ in vitro organ culture (IVOC) systems similar to those used for other Shigella studies. Human colonic pinch biopsies co-cultured with Shigella strains provide an excellent model to study bacterial interactions with host tissue . For ugpA-specific studies, researchers could implement the following methodology:

  • Culture human colonic tissue explants in IVOC medium

  • Inoculate with wild-type or ugpA-mutant Shigella dysenteriae (approximately 10^9 CFU)

  • Replace medium after 4 hours to maintain pH and nutrient levels

  • Re-inoculate with bacteria and continue incubation for a total of 24 hours

  • Collect and analyze culture media for bacterial load and host response factors

  • Process tissue samples for histopathological examination using H&E staining

This approach allows for the assessment of bacterial colonization, invasion capabilities, and host tissue responses in a model that closely resembles in vivo conditions.

How can researchers develop effective antibodies against ugpA for research applications?

Developing effective antibodies against ugpA requires careful antigen design and validation strategies. Based on approaches used for other Shigella proteins, researchers should consider:

  • Epitope selection: Identify unique, surface-exposed regions of ugpA that distinguish it from homologous proteins in related bacteria

  • Recombinant antigen production: Express the full-length protein or specific antigenic domains using an E. coli expression system

  • Immunization strategy: Employ a prime-boost schedule with purified protein adjuvanted appropriately

  • Antibody validation: Test specificity using Western blot against both recombinant protein and native protein from Shigella lysates

  • Cross-reactivity assessment: Evaluate potential cross-reactivity with related proteins, particularly ugpE and homologs from E. coli

For monoclonal antibody development, researchers should screen hybridomas for those producing antibodies with high specificity and affinity for functional assays such as immunofluorescence and immunoprecipitation studies.

What functional assays can be employed to study ugpA activity?

Several functional assays can be adapted to study ugpA activity in the context of sn-glycerol-3-phosphate transport:

  • Transport assays: Measure the uptake of radiolabeled or fluorescently labeled sn-glycerol-3-phosphate in bacterial cells expressing wild-type or mutant ugpA

  • Growth complementation: Assess the ability of ugpA to restore growth of ugpA-deficient strains in media where sn-glycerol-3-phosphate is the sole carbon source

  • Invasion assays: Using cell lines such as Caco-2, compare invasion efficiency between wild-type and ugpA-mutant strains

  • Bacterial adhesion/invasion inhibition assays (AIA): Determine if antibodies targeting ugpA can inhibit bacterial adhesion or invasion processes

For invasion assays specifically, researchers can adopt established protocols:

  • Culture Caco-2 cells to form monolayers in appropriate flasks or plates

  • Prepare overnight cultures of Shigella strains (wild-type and ugpA mutants)

  • Determine multiplicity of infection (MOI) – typically 100 bacteria per Caco-2 cell

  • Add approximately 10^11 CFU of Shigella to flasks containing 10^9 Caco-2 cells

  • Co-culture at 37°C with 5% CO2 for 3 hours

  • Remove supernatant, wash with PBS, and add DMEM with gentamicin (150 μg/ml)

  • Incubate at 37°C with 5% CO2 for 30 minutes

  • Lyse cells with 0.1% Triton X-100 and quantify intracellular bacteria

How should researchers interpret contradictory results regarding ugpA function?

When encountering contradictory results in ugpA functional studies, researchers should systematically evaluate:

  • Strain variations: Different Shigella dysenteriae strains may exhibit variability in ugpA sequence and regulation

  • Experimental conditions: Temperature, pH, growth phase, and culture media can significantly impact transporter functionality

  • Expression levels: Over-expression or under-expression of ugpA may lead to non-physiological outcomes

  • Functional redundancy: Other transporters may compensate for ugpA deficiency under certain conditions

  • Post-translational modifications: Different expression systems may produce ugpA with varying modifications affecting function

To resolve contradictions, researchers should implement parallel experiments using:

  • Multiple Shigella strains

  • Different growth conditions

  • Complementation studies

  • Combinatorial gene knockout approaches

  • Careful quantification of ugpA expression levels

How can CRISPR-Cas9 technology be applied to study ugpA function?

CRISPR-Cas9 technology offers powerful approaches for studying ugpA function through precise genetic manipulation. Researchers can implement the following strategies:

  • Gene knockout: Create complete ugpA deletion mutants to assess its essentiality and phenotypic effects

  • Domain-specific mutations: Introduce point mutations in functional domains to assess their impact on transport activity

  • Promoter modifications: Alter ugpA expression levels by modifying promoter regions

  • Reporter gene fusions: Create translational fusions with fluorescent proteins to monitor expression and localization

  • CRISPRi approach: Use deactivated Cas9 (dCas9) to repress ugpA expression without genetic modification

When designing CRISPR experiments for ugpA, researchers should carefully select guide RNAs to minimize off-target effects and implement appropriate controls, including complementation with wild-type ugpA to confirm phenotype specificity.

What potential applications does recombinant ugpA have in vaccine development?

While ugpA itself has not been specifically highlighted as a vaccine candidate in the search results, insights can be drawn from other Shigella antigen research. Shigella vaccine development has traditionally focused on O-polysaccharide (OPS) conjugates and invasion plasmid antigens (Ipa proteins) .

As a conserved membrane protein, ugpA could potentially serve as:

  • A carrier protein for Shigella O-polysaccharide conjugate vaccines, similar to how IpaB has been used

  • A component in subunit vaccine formulations targeting multiple bacterial antigens

  • A target for antibody-mediated bactericidal or opsonization effects

Researchers exploring this direction should consider:

  • The conservation of ugpA across different Shigella serotypes

  • The accessibility of ugpA epitopes in intact bacteria

  • The potential for functional antibodies that might inhibit nutrient acquisition

  • The immunogenicity of ugpA in animal models and human samples

Novel approaches like incorporating non-native amino acids (nnAA) for site-specific conjugation using click chemistry, as demonstrated with IpaB , could potentially be applied to ugpA-based vaccine development.

What bioinformatic tools are most effective for ugpA structure-function analysis?

For comprehensive structure-function analysis of ugpA, researchers should employ a combination of bioinformatic tools:

Analysis TypeRecommended ToolsApplication
Sequence alignmentMUSCLE, Clustal Omega, T-CoffeeIdentify conserved domains and evolutionary relationships
Structural predictionAlphaFold2, I-TASSER, SWISS-MODELGenerate 3D structural models
Transmembrane topologyTMHMM, TOPCONS, PhobiusPredict membrane-spanning regions
Functional domain predictionInterProScan, Pfam, SMARTIdentify functional motifs and domains
Molecular dynamicsGROMACS, NAMD, AMBERSimulate protein behavior in membrane environments
Protein-protein interactionHDOCK, ClusPro, HADDOCKModel interactions with other transport system components

These analyses can reveal critical functional sites for experimental targeting and provide hypotheses about transport mechanisms that can be tested experimentally.

How can transcriptomic and proteomic approaches enhance understanding of ugpA regulation?

Multi-omics approaches can provide comprehensive insights into ugpA regulation:

  • RNA-Seq analysis: Measure ugpA transcript levels under different growth conditions and during various phases of infection to identify regulatory patterns

  • Proteomics: Quantify ugpA protein abundance using mass spectrometry-based approaches to understand post-transcriptional regulation

  • Ribosome profiling: Assess translational efficiency of ugpA mRNA under different conditions

  • ChIP-Seq: Identify transcription factors binding to the ugpA promoter region

  • Protein-protein interaction studies: Use pull-down assays coupled with mass spectrometry to identify protein complexes involving ugpA

Data integration across these platforms requires sophisticated bioinformatic approaches, including network analysis and machine learning algorithms to identify regulatory patterns not evident in single-omics datasets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.