Recombinant Shigella dysenteriae serotype 1 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Overview of Shigella dysenteriae serotype 1

Shigella dysenteriae serotype 1 (SD1) causes a severe form of bacillary dysentery in humans, known as shigellosis . This bacterium is transmitted through the oral-fecal route and has a low infectious dose . Once ingested, SD1 infects the cecum, invades the colonic mucosa, and causes symptoms, including diarrhea, fever, and cramps . In severe, untreated cases, particularly in children and immunocompromised individuals, the mortality rate can be high .

The Role of MdtI in Shigella

MdtI is a spermidine export protein involved in polyamine transport in Shigella . Polyamines, such as spermidine, are essential for bacterial virulence . The polyamine profile of Shigella differs from that of E. coli, with increased spermidine levels in Shigella, which favors the expression of its virulent phenotype .

MdtJI Complex and its Regulation

MdtI is part of the MdtJI complex, an efflux pump that belongs to the small multidrug resistance (SMR) family of transporters . The expression of the mdtJI operon in Shigella is influenced by several factors .

  • Spermidine Levels: High levels of spermidine in Shigella increase mdtJI expression .

  • VirF Regulator: VirF, a plasmid-encoded regulator of the Shigella virulence regulatory cascade, stimulates mdtJI expression .

  • Bile Components: Bile components also stimulate the expression of mdtJI .

  • H-NS Protein: In E. coli, the mdtJI operon is repressed by H-NS, a nucleoid protein, which directly binds to the regulatory region .

MdtJI promotes the excretion of putrescine, a spermidine precursor . It acts as a safety valve, helping Shigella maintain optimal spermidine levels necessary for survival within infected macrophages while preventing spermidine over-accumulation .

Recombinant MdtI Protein

Recombinant MdtI protein is produced using genetic engineering techniques, often expressed in E. coli . For example, Creative BioMart offers a recombinant full-length Shigella sonnei Spermidine export protein MdtI (MdtI) with a His-tag . This protein is available as a lyophilized powder with greater than 90% purity, as determined by SDS-PAGE .

Characteristics of Recombinant MdtI Protein

FeatureDescription
SpeciesShigella sonnei
SourceE. coli
TagHis-tag
Protein LengthFull Length (1-109aa)
FormLyophilized powder
PurityGreater than 90% by SDS-PAGE
StorageStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage
Gene NamemdtI
SynonymsmdtI; SSON_1561; Spermidine export protein MdtI
UniProt IDQ3Z1V2
Amino Acid SequenceMAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Research Applications

Recombinant MdtI protein can be utilized in various research applications, including:

  • ** изучения Structure-function studies**: Investigating the mechanisms by which MdtI transports spermidine and other polyamines.

  • Drug Development: Developing novel drugs that target MdtI to disrupt polyamine transport and reduce Shigella's virulence.

  • Biochemical Assays: Using the purified protein in biochemical assays to identify inhibitors or substrates.

  • Structural Biology: Determining the three-dimensional structure of MdtI to understand its function at the molecular level.

  • Vaccine development: Outer membrane protein OmpA, the heat shock protein HtpG and OspC2 represent novel SD1 subunit vaccine candidates and drug targets .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.

Synonyms
mdtI; SDY_1554; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSQAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLT
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links

KEGG: sdy:SDY_1554

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella dysenteriae and why is it significant in research?

Shigella dysenteriae is a Gram-negative, non-spore-forming, nonmotile, facultative aerobic, rod-shaped bacterium first discovered in 1897. It belongs to the genus Shigella, which causes disease primarily in primates including humans and gorillas, but not in other mammals . Shigella is closely related to E. coli and represents one of the leading bacterial causes of diarrhea worldwide, particularly in African and South Asian children .

S. dysenteriae is one of four Shigella species (along with S. flexneri, S. boydii, and S. sonnei) and is associated with serotype 1 strains that can cause severe dysentery . While S. flexneri is the most commonly isolated species worldwide (accounting for approximately 60% of cases), S. dysenteriae serotype 1 remains a significant research focus due to its association with epidemic outbreaks and severe clinical presentations .

Research on S. dysenteriae is particularly important due to increasing antimicrobial resistance patterns observed in clinical isolates, making it a critical public health concern requiring novel therapeutic approaches .

What is the Spermidine export protein MdtI and what is its function?

Spermidine export protein MdtI is a membrane transport protein that belongs to the small multidrug resistance (SMR) family of drug exporters. Its primary function is to catalyze the excretion of spermidine, a naturally occurring polyamine, from bacterial cells . MdtI works in conjunction with MdtJ to form the MdtJI complex, which functions as an active transport system for removing excess spermidine from the cellular environment .

Functionally, the MdtJI complex plays a crucial role in polyamine homeostasis, protecting bacterial cells from the toxicity associated with spermidine overaccumulation. When intracellular spermidine concentrations become elevated to potentially toxic levels, the MdtJI complex facilitates its export across the cell membrane, thereby maintaining appropriate intracellular polyamine levels .

Experimental evidence demonstrates that bacterial cells expressing functional MdtJI show decreased intracellular spermidine content when grown in spermidine-rich environments and exhibit enhanced recovery from polyamine toxicity compared to cells lacking these proteins .

How does the MdtI protein relate to multidrug resistance?

The MdtI protein belongs to the small multidrug resistance (SMR) family of drug exporters, a classification that reflects its structural and functional relationships with proteins involved in antimicrobial resistance mechanisms . While MdtI's primary characterized function involves spermidine export, its membership in the SMR family suggests potential broader roles in drug efflux processes.

Recent research on Shigella outbreaks has documented increasing multidrug resistance (MDR) profiles, with inappropriate therapy being significantly more common among patients with MDR Shigella infections (31.7% versus 10.5% in non-MDR infections; OR 3.9, 95% CI: 1.3–13, p=0.007) . Understanding the potential contributions of efflux proteins like MdtI to these resistance patterns represents an important research direction.

What is the relationship between MdtI and MdtJ proteins?

MdtI and MdtJ function as obligate partners in a heterodimeric protein complex (MdtJI) that facilitates spermidine export across the bacterial cell membrane . This relationship is functionally essential, as experimental evidence demonstrates that both mdtJ and mdtI are necessary for recovery from spermidine toxicity in bacterial cells .

The nature of this protein-protein interaction is consistent with the behavior of other SMR family transporters, which often require oligomerization to form functional transport channels. When bacterial cells are transformed with plasmids encoding both MdtJ and MdtI (pUCmdtJI or pMWmdtJI), they demonstrate recovery from spermidine toxicity, decreased intracellular spermidine content when cultured in spermidine-rich environments, and enhanced spermidine excretion capabilities .

Neither protein appears capable of functioning independently as a spermidine exporter, highlighting the obligate nature of their interaction. This interdependence suggests coordinated expression and assembly of the complex components under physiological conditions.

What are the standard methods for expressing recombinant MdtI protein?

Recombinant expression of Shigella dysenteriae MdtI protein typically employs heterologous expression systems optimized for membrane protein production. Several expression platforms have been successfully employed for recombinant production of membrane transporters from the SMR family, including:

  • E. coli expression systems: The most common approach utilizes E. coli strains such as BL21(DE3), C41(DE3), or C43(DE3) - the latter two being particularly suitable for membrane protein expression . Expression vectors containing inducible promoters (T7, tac, or araBAD) allow controlled expression, typically with N- or C-terminal affinity tags (His6, FLAG, or Strep) to facilitate purification.

  • Yeast expression systems: Pichia pastoris and Saccharomyces cerevisiae provide eukaryotic expression environments that can improve folding of challenging membrane proteins .

  • Baculovirus expression: Insect cell expression using baculovirus vectors offers another alternative for membrane proteins that may not express well in prokaryotic systems .

  • Mammalian cell expression: For functional studies requiring mammalian cellular environment, transient or stable expression in mammalian cell lines can be employed .

Recombinant MdtI is typically expressed with its partner protein MdtJ when functional studies are planned, as both proteins are required for spermidine transport activity . Optimal expression conditions must be experimentally determined through systematic testing of induction parameters (temperature, inducer concentration, and duration).

How can researchers evaluate the functional activity of MdtI in vitro?

Functional assessment of MdtI activity requires appropriate experimental systems that can measure spermidine transport. Several methodological approaches have been validated:

  • Growth recovery assays: Bacterial strains deficient in spermidine acetyltransferase (an enzyme that metabolizes spermidine) are particularly sensitive to spermidine toxicity. Transformation of these strains with functional MdtJI-expressing plasmids results in measurable growth recovery when cultured in spermidine-containing media. This provides a simple functional readout of MdtI activity .

  • Spermidine content measurement: Quantification of intracellular spermidine levels can be performed using:

    • HPLC analysis of dansylated polyamines

    • LC-MS/MS methods

    • Radioisotope-labeled spermidine tracking

  • Spermidine excretion measurement: Direct measurement of spermidine export can be accomplished by:

    • Monitoring spermidine accumulation in culture media over time

    • Using radioactively labeled spermidine to track export kinetics

  • Reconstitution in proteoliposomes: Purified MdtI and MdtJ proteins can be reconstituted into artificial membrane vesicles (proteoliposomes) to study transport kinetics under defined conditions.

When conducting these assays, researchers should include appropriate controls, such as cells expressing non-functional MdtI mutants or cells lacking the MdtI expression construct.

What genetic approaches are used to study mdtI gene expression?

Several genetic approaches can be employed to study mdtI gene expression:

  • Transcriptional reporter fusions: The mdtI promoter region can be fused to reporter genes such as lacZ (β-galactosidase), gfp (green fluorescent protein), or luciferase to quantitatively measure promoter activity under different conditions. These constructs enable monitoring of how mdtI expression responds to environmental conditions like elevated spermidine levels .

  • RT-qPCR analysis: Reverse transcription quantitative PCR provides a sensitive method for measuring mdtI mRNA levels, allowing precise quantification of transcriptional responses. This technique was used to demonstrate that mdtJI mRNA levels increase in response to spermidine exposure .

  • Northern blotting: While less sensitive than RT-qPCR, this technique can provide information about transcript size and stability.

  • RNA-Seq analysis: This high-throughput approach allows genome-wide transcriptional profiling, placing mdtI expression in the context of global gene expression patterns.

  • Chromatin immunoprecipitation (ChIP): To identify transcription factors that regulate mdtI expression, ChIP experiments can identify protein-DNA interactions at the mdtI promoter.

These approaches can be combined with genetic manipulations (gene knockouts, point mutations in regulatory elements) to dissect the regulatory networks controlling mdtI expression. The finding that mdtJI mRNA levels increase in response to spermidine suggests specific regulatory mechanisms that can be further characterized using these techniques .

How can mutational studies be designed to investigate MdtI function?

Mutational studies represent a powerful approach for investigating structure-function relationships in MdtI. A comprehensive experimental design would include:

  • Site-directed mutagenesis: Based on sequence conservation analysis and structural predictions, specific amino acid residues can be targeted for mutation. For MdtI, residues Glu5, Glu19, Asp60, Trp68, and Trp81 have been identified as functionally important and serve as priority targets . Mutations typically include:

    • Conservative substitutions (maintaining charge or size)

    • Non-conservative substitutions (altering physicochemical properties)

    • Alanine scanning (sequential replacement with alanine)

  • Random mutagenesis: Approaches such as error-prone PCR or chemical mutagenesis can generate libraries of random MdtI mutants for functional screening.

  • Functional screening: Mutant libraries can be screened using:

    • Growth-based assays in spermidine-toxic conditions

    • Transport assays measuring spermidine export efficiency

    • Protein interaction assays to assess MdtI-MdtJ complex formation

  • Structure-guided mutagenesis: As structural information becomes available (through crystallography, cryo-EM, or modeling), more targeted mutagenesis can focus on predicted functional domains, binding sites, or channel-forming regions.

  • Complementation analysis: Testing whether mutant versions of MdtI can restore function in mdtI-deficient strains provides a direct assessment of functional consequences.

Research has already identified several key residues in MdtI (Glu5, Glu19, Asp60, Trp68, and Trp81) that impact spermidine export function through such mutational approaches .

What are the critical amino acid residues for MdtI function and how were they identified?

Critical amino acid residues in MdtI have been identified through systematic mutational analysis coupled with functional assays. Research has revealed several key residues essential for spermidine export activity:

Table 1: Critical Amino Acid Residues in MdtI and Their Functional Significance

ProteinResidueTypePotential RoleExperimental Evidence
MdtIGlu5AcidicSubstrate recognition/bindingMutation disrupts spermidine export
MdtIGlu19AcidicTransport mechanism/proton couplingMutation disrupts spermidine export
MdtIAsp60AcidicIon coordinationMutation disrupts spermidine export
MdtITrp68AromaticMembrane interface/substrate translocationMutation disrupts spermidine export
MdtITrp81AromaticMembrane interface/substrate translocationMutation disrupts spermidine export

These residues were identified through targeted mutagenesis followed by functional assessment of the mutant proteins' ability to confer spermidine resistance and facilitate spermidine export . The predominance of acidic residues (Glu, Asp) suggests their importance in interacting with the positively charged polyamine substrate, while the aromatic tryptophan residues likely contribute to substrate recognition, protein stability, or transport channel formation.

For comparison, in the partner protein MdtJ, residues Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 have been identified as functionally significant . The different pattern of critical residues between MdtI and MdtJ suggests complementary roles within the heterodimeric complex.

How does spermidine influence mdtI expression and what are the regulatory mechanisms?

Spermidine has been demonstrated to increase the expression of mdtJI mRNA, suggesting the existence of a substrate-induced regulatory mechanism . This feedback regulation likely helps bacterial cells respond to elevated polyamine levels by increasing the production of export machinery. Several potential regulatory mechanisms may be involved:

  • Transcriptional regulation: Spermidine may interact with transcriptional regulators that bind to the mdtJI promoter region. Candidate regulatory systems include:

    • Polyamine-responsive transcription factors

    • Two-component regulatory systems responsive to membrane stress

    • Global regulators of stress response pathways

  • Post-transcriptional regulation: Spermidine could influence mRNA stability or translation efficiency through:

    • Direct interaction with RNA secondary structures (riboswitches)

    • Effects on RNA-binding proteins that regulate mdtJI mRNA

    • Influence on small regulatory RNAs that target mdtJI transcripts

  • Indirect regulatory effects: Spermidine accumulation may trigger cellular stress responses that indirectly upregulate mdtJI through:

    • Membrane perturbation sensing pathways

    • Cellular damage response mechanisms

    • Metabolic stress signaling

Experimental approaches to dissect these mechanisms include promoter deletion analysis, identification of transcription factor binding sites, RNA stability assays, and genetic screens for regulatory mutants. The finding that mdtJI mRNA levels increase in response to spermidine provides a foundation for these more detailed regulatory studies .

What structural factors contribute to the substrate specificity of MdtI?

The substrate specificity of MdtI appears finely tuned for spermidine transport, with several structural factors likely contributing to this selectivity:

  • Presence of acidic residues: The identified critical residues in MdtI include several acidic amino acids (Glu5, Glu19, Asp60) that likely create a negatively charged microenvironment well-suited for interaction with the positively charged polyamine substrate . This electrostatic complementarity likely contributes significantly to substrate recognition.

  • Aromatic residues: The critical tryptophan residues (Trp68, Trp81) may provide cation-π interactions with the positively charged amine groups of spermidine . These interactions are known to be important in other polyamine-binding proteins.

  • Transmembrane domain arrangement: As a member of the SMR family, MdtI likely possesses multiple transmembrane domains that create a transport channel with specific dimensional constraints that accommodate spermidine's linear structure.

  • Heterodimeric complex formation: The necessity of both MdtI and MdtJ for functional spermidine transport suggests that the interface between these proteins creates a substrate-binding pocket or transport pathway with specific geometric and electrostatic properties .

  • Binding site architecture: The specific arrangement of side chains within the substrate-binding region likely creates a molecular recognition site that discriminates between spermidine and other polyamines based on charge distribution, molecular length, and flexibility.

Further structural studies, including crystallography, cryo-electron microscopy, or computational modeling informed by experimental constraints, would help elucidate these structural determinants in greater detail.

How can computational approaches enhance our understanding of MdtI structure-function relationships?

Computational approaches offer powerful tools for investigating MdtI structure-function relationships, especially given the challenges associated with experimental structural determination of membrane proteins:

These computational approaches can generate testable hypotheses about MdtI function, guide experimental design, and help interpret experimental results within a structural framework.

What potential applications exist for targeting MdtI in antimicrobial development?

The MdtI protein represents a potential target for novel antimicrobial development strategies, particularly in the context of multidrug-resistant Shigella infections:

  • Inhibitor development: Small molecules that specifically inhibit MdtI function could potentially:

    • Disrupt polyamine homeostasis in Shigella

    • Increase intracellular spermidine to toxic levels

    • Potentially sensitize bacteria to existing antibiotics

  • Combination therapy approaches: MdtI inhibitors could be developed as adjuvants to:

    • Enhance efficacy of existing antibiotics

    • Overcome specific resistance mechanisms

    • Reduce required antibiotic doses

  • Vaccine development: Recombinant MdtI protein could potentially serve as:

    • A component in multiepitope vaccine formulations

    • A carrier protein for Shigella-specific antigens

    • A target for generating neutralizing antibodies

  • Diagnostic applications: Detection of MdtI or its expression patterns might:

    • Identify specific antimicrobial resistance profiles

    • Guide appropriate treatment selection

    • Monitor treatment efficacy

The increasing prevalence of multidrug-resistant Shigella strains, as documented in recent outbreaks where inappropriate therapy was significantly more common among patients with MDR Shigella (31.7% vs. 10.5%; OR 3.9, p=0.007), underscores the need for novel therapeutic approaches . Targeting non-essential but fitness-enhancing functions like polyamine export could provide selective pressure without immediately triggering resistance development.

How does MdtI differ across Shigella species and what are the evolutionary implications?

Comparative analysis of MdtI across Shigella species reveals evolutionary patterns that may inform both basic biology and applied research:

These differences may contribute to species-specific adaptation to different host environments or virulence properties.

  • Evolutionary relationship with E. coli: Given Shigella's close relationship to E. coli , comparative analysis between E. coli MdtI and Shigella MdtI can illuminate:

    • Adaptive changes following divergence from a common ancestor

    • Selection pressures acting on polyamine transport systems

    • Horizontal gene transfer events affecting transporter diversity

  • Potential selective pressures: Various factors may have shaped MdtI evolution, including:

    • Host polyamine environments during infection

    • Exposure to antimicrobial compounds

    • Requirements for bacterial survival in diverse environments

These evolutionary patterns may help explain the variable prevalence of different Shigella species in clinical settings, where S. flexneri accounts for approximately 60% of isolates worldwide, while S. dysenteriae is associated with more severe dysenteric presentations .

What are the current research gaps in understanding MdtI function?

Despite progress in characterizing MdtI, several significant knowledge gaps remain:

  • Structural characterization: No high-resolution three-dimensional structure of MdtI or the MdtJI complex is currently available. This limits understanding of:

    • Precise substrate binding mechanisms

    • Conformational changes during transport

    • Structural basis for MdtI-MdtJ interaction

    • Rational design of inhibitors

  • Transport mechanism: The bioenergetic basis of spermidine transport remains incompletely characterized:

    • Is transport coupled to ion gradients (H⁺, Na⁺)?

    • What is the stoichiometry of spermidine/ion exchange?

    • What are the rate-limiting steps in the transport cycle?

  • Physiological role in Shigella pathogenesis:

    • How does MdtI function contribute to Shigella survival in host environments?

    • Is MdtI expression altered during different stages of infection?

    • Does MdtI function influence virulence gene expression?

  • Regulatory networks:

    • Complete characterization of transcriptional regulators controlling mdtI expression

    • Understanding of post-transcriptional regulatory mechanisms

    • Integration of polyamine sensing with broader stress responses

  • Substrate spectrum:

    • Beyond spermidine, does MdtI transport other polyamines or compounds?

    • What structural features determine substrate selectivity?

    • Can the substrate specificity be altered through mutation?

Addressing these gaps would significantly advance both basic understanding of bacterial polyamine transport and potential applications in antimicrobial development against increasingly resistant Shigella strains .

How might MdtI research contribute to understanding polyamine metabolism in bacteria?

Research on MdtI provides a valuable window into broader aspects of bacterial polyamine metabolism and regulation:

  • Polyamine homeostasis mechanisms: MdtI represents one component of complex polyamine regulatory networks that balance:

    • Biosynthesis pathways

    • Import systems

    • Metabolic interconversion

    • Export mechanisms

Understanding MdtI's role helps complete the picture of how bacteria maintain optimal polyamine levels.

  • Stress response integration: Polyamine metabolism intersects with multiple stress response pathways:

    • Oxidative stress protection

    • Acid resistance

    • Biofilm formation

    • Antibiotic tolerance

MdtI research may reveal how polyamine export contributes to these adaptive responses.

  • Host-pathogen interactions: In infection contexts, bacterial and host polyamine systems interact:

    • Competition for polyamine resources

    • Host-derived polyamines as environmental signals

    • Polyamine-dependent virulence gene regulation

MdtI function may influence these interactions during Shigella infection.

  • Evolutionary adaptation: Comparative analysis of polyamine transporters including MdtI across bacterial species can reveal:

    • Adaptive strategies for different ecological niches

    • Convergent evolution of transport mechanisms

    • Selective pressures shaping polyamine management systems

  • Metabolic network integration: Polyamine metabolism connects to core cellular processes:

    • Nucleic acid stability and function

    • Translation efficiency

    • Cell division

    • Membrane integrity

MdtI research helps define how polyamine export influences these fundamental processes, potentially explaining why S. flexneri accounts for approximately 60% of Shigella isolates worldwide while S. dysenteriae is associated with more severe presentations .

How can researchers overcome expression challenges with recombinant MdtI?

Membrane proteins like MdtI often present significant expression challenges. Researchers can employ several strategies to overcome these difficulties:

  • Optimization of expression systems:

    • Test multiple expression hosts (E. coli, yeast, insect cells, mammalian cells)

    • Evaluate specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21)

    • Screen different promoter systems for optimal expression levels

  • Construct design considerations:

    • Test both N- and C-terminal affinity tags to identify optimal configuration

    • Include purification tags separated by protease-cleavable linkers

    • Consider fusion partners that enhance folding and stability (GFP, MBP, SUMO)

    • Optimize codon usage for the expression host

  • Expression condition screening:

    • Systematically vary induction parameters:

      • Temperature (typically lower temperatures improve folding)

      • Inducer concentration (lower levels may reduce aggregation)

      • Induction duration

      • Media composition (including supplementation with membrane components)

  • Co-expression strategies:

    • Express MdtI together with its partner protein MdtJ to stabilize the complex

    • Co-express with chaperones to improve folding

    • Include accessory proteins that may facilitate assembly

  • Solubilization and purification approaches:

    • Screen multiple detergents for optimal extraction efficiency

    • Test newer amphipathic polymers (SMALPs, amphipols)

    • Consider nanodiscs for maintaining native-like environment

Monitoring expression using techniques like Western blotting, fluorescence (if using GFP fusions), or functional assays helps identify the most promising conditions for further optimization.

What strategies help resolve data inconsistencies in MdtI functional assays?

When encountering inconsistent results in MdtI functional assays, researchers can employ the following troubleshooting strategies:

  • Standardize experimental conditions:

    • Establish precisely defined growth conditions (media, temperature, aeration)

    • Use consistent expression levels through careful inducer titration

    • Standardize cell density for assays using accurate OD600 measurements

    • Define exact timing for measurements relative to induction

  • Implement comprehensive controls:

    • Include non-transformed cells as negative controls

    • Use cells expressing known non-functional MdtI mutants

    • Include positive controls with established efflux activity

    • Perform parallel assays with different substrates to assess specificity

  • Validate protein expression and localization:

    • Confirm MdtI expression levels by Western blotting

    • Verify membrane localization through fractionation studies

    • Assess complex formation between MdtI and MdtJ

    • Check for potential degradation products

  • Improve assay precision:

    • Increase biological and technical replicates

    • Implement internal standards for spermidine quantification

    • Utilize multiple complementary assay methods

    • Perform time-course measurements to capture dynamics

  • Address potential interfering factors:

    • Test for effects of growth phase on transport activity

    • Evaluate potential metabolic conversion of spermidine

    • Check for expression of endogenous transporters that might compensate

    • Consider effects of media components on assay readouts

By methodically addressing these factors, researchers can identify sources of variability and develop more robust, reproducible functional assays for MdtI.

How can specificity be ensured when studying MdtI in the presence of other transporters?

Ensuring specificity when studying MdtI in complex bacterial systems with multiple transporters requires careful experimental design:

  • Genetic approaches:

    • Generate clean genetic backgrounds by deleting endogenous transporters

    • Create strains with chromosomal mutations in mdtI for complementation studies

    • Use CRISPR-Cas9 for precise genetic modifications without markers

    • Implement inducible expression systems to control MdtI levels

  • Pharmacological strategies:

    • Employ specific inhibitors of other known transporters when available

    • Use chemically defined minimal media to reduce transport substrate complexity

    • Perform competition assays with unlabeled substrates to assess specificity

    • Test substrate analogs with different structural features

  • Biochemical approaches:

    • Purify MdtI (with MdtJ) and reconstitute in proteoliposomes for isolated system studies

    • Perform transport assays with purified components to eliminate interference

    • Use radioactively or fluorescently labeled substrates for direct tracking

    • Implement substrate binding assays to complement transport measurements

  • Analytical considerations:

    • Employ high-resolution analytical methods (HPLC-MS/MS) for specific substrate detection

    • Use kinetic analysis to distinguish transport systems with different affinities

    • Implement mathematical modeling to deconvolute contributions of multiple transporters

    • Compare transport patterns across different substrates to establish specificity profiles

  • Experimental controls:

    • Compare wild-type cells with isogenic mdtI deletion mutants

    • Use cells expressing catalytically inactive MdtI mutants (with alterations in key residues like Glu5, Glu19, Asp60, Trp68, or Trp81)

    • Assess transport under conditions where MdtI expression is specifically induced or repressed

These approaches collectively help isolate and characterize MdtI-specific functions even in the complex context of multiple bacterial transport systems.

What controls are essential for validating MdtI-focused experiments?

Robust experimental design for MdtI research requires several essential controls to ensure valid and interpretable results:

  • Genetic controls:

    • Negative controls: Isogenic strains with mdtI deletion or inactivation

    • Complementation controls: mdtI mutants complemented with wild-type gene

    • Partner protein controls: Strains expressing MdtI without MdtJ to confirm complex requirement

    • Specificity controls: Strains with mutations in other transporters to rule out compensatory effects

  • Expression controls:

    • Expression level verification: Western blots or reporter assays to confirm consistent expression

    • Localization controls: Membrane fraction analysis to confirm proper targeting

    • Induction controls: Uninduced samples to assess basal expression effects

    • Toxicity controls: Growth curves to ensure expression doesn't cause general cellular stress

  • Functional assay controls:

    • Substrate specificity controls: Testing structurally related compounds to confirm selectivity

    • Transport directionality controls: Inside-out vesicles vs. whole cells to confirm export function

    • Energy dependence controls: Tests with metabolic inhibitors to confirm active transport

    • Time course controls: Multiple time points to establish transport kinetics

  • Analytical controls:

    • Method validation controls: Standard curves with known substrate concentrations

    • Sample processing controls: Monitoring potential substrate degradation during preparation

    • Matrix effect controls: Assessing influence of cellular components on measurements

    • Internal standards: For accurate quantification in analytical methods

  • Biological relevance controls:

    • Physiological condition controls: Testing under conditions mimicking relevant environments

    • Stress response controls: Distinguishing specific MdtI effects from general stress responses

    • Strain background controls: Testing in multiple genetic backgrounds to ensure generalizability

    • Species comparison controls: Parallel experiments in S. dysenteriae and related species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.