Recombinant Shigella dysenteriae serotype 1 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Overview of Shigella dysenteriae serotype 1

Shigella dysenteriae serotype 1 (SD1) is a bacterium that causes severe bacillary dysentery, also known as shigellosis . This illness primarily affects humans and primates and spreads through the fecal-oral route . SD1 can survive in contaminated food or water, and only a small number of organisms (10–100) are needed to cause infection . Shigellosis begins as an acute infection in the cecum, followed by bacterial invasion of the colonic mucosa, leading to symptoms such as cramps, diarrhea, and fever . The destruction of the epithelial cell barrier and the infiltration of inflammatory cells into the gut mucosa can result in colonic bleeding . Untreated infections, especially in young children and immunocompromised individuals, can be fatal in 10–15% of cases .

Multidrug Resistance and Virulence Factors

Multidrug-resistant Shigella dysenteriae serotype 1 strains have re-emerged in patients hospitalized with diarrhea in Kolkata, India . All S. dysenteriae 1 strains harbor stx1 (Shiga toxin), ipaH (invasion plasmid antigen H), and ial (invasion-associated locus) genes, and are negative for the set (Shigella enterotoxin 1) gene . Additionally, a significant proportion of isolates are positive for the sen (Shigella enterotoxin 2) gene .

Proteomic Analysis of Shigella dysenteriae serotype 1

Comprehensive proteome analysis of Shigella dysenteriae serotype 1 (SD1) has identified 1061 distinct gene products . Differential display analysis revealed that SD1 cells switch to anaerobic energy metabolism in vivo . High in vivo abundances of amino acid decarboxylases (GadB and AdiA), which enhance pH homeostasis in the cytoplasm, and protein disaggregation chaperones (HdeA, HdeB, and ClpB) indicate a coordinated bacterial survival response to acid stress . Several type III secretion system (T3SS) effectors, including OspF, IpaC, and IpaD, were increased in abundance in vivo, suggesting their involvement in the invasion of colonocytes and subversion of the host immune response .

Recombinant Production of O-Polysaccharide

Recombinant E. coli strains expressing specific glycosyltransferase genes (rfbR, rfbQ, and rfp) can generate the O-polysaccharide (O-PS, O-antigen) of S. dysenteriae 1 . This approach allows for the synthesis of specific O-antigen ladder types with different chain lengths of O-repeat units . Mass spectrometry and ion chromatography analysis have confirmed the generation of the specific S. dysenteriae 1 O-repeat unit structure with an extra glucose residue attached .

MdtJ (Spermidine Export Protein)

MdtJ is a spermidine export protein in Shigella dysenteriae serotype 1 . It is a 121 amino acid protein . MdtJ is involved in multidrug resistance .

Table 1. Key features of MdtJ

FeatureDescription
Recommended NameSpermidine export protein MdtJ
Gene NamemdtJ
Ordered Locus NameSDY_1553
Expression Region1-121
Sequence Length121 amino acids
AA SequenceMYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILmLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mdtJ; SDY_1553; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links

KEGG: sdy:SDY_1553

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtJ in Shigella dysenteriae serotype 1?

MdtJ is a membrane protein in Shigella dysenteriae serotype 1 that functions as a spermidine export protein. It belongs to the small multidrug resistance (SMR) family of drug exporters, which are characterized by their relatively small size and ability to transport various compounds across cell membranes . MdtJ specifically works in conjunction with another protein, MdtI, to form the MdtJI complex that facilitates the excretion of spermidine, a polyamine essential for normal cell growth but toxic when overaccumulated .

The protein's function is particularly important for bacterial survival when cells face high concentrations of spermidine. Experimental evidence demonstrates that expression of the mdtJI genes significantly enhances cell viability and growth in conditions of spermidine overaccumulation, suggesting its role as a protective mechanism against polyamine toxicity . Research has identified several key amino acid residues in MdtJ, including Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82, that are critical for its excretion activity, providing insights into the molecular basis of its function .

What is the functional relationship between MdtJ and MdtI proteins?

MdtJ and MdtI function together as a heterodimeric protein complex (MdtJI) that catalyzes the excretion of spermidine from bacterial cells . This partnership is obligatory, as research has demonstrated that both proteins are necessary for recovery from spermidine toxicity—neither protein alone can restore cell viability in the presence of high spermidine concentrations . The complementary roles of these proteins likely arise from their distinct structural features that collectively create a functional transport channel.

In experimental settings, transformation with both mdtJ and mdtI genes is required to observe significant increases in cell viability during culture with high spermidine concentrations (2 mM and 12 mM) . When the MdtJI complex is expressed in Escherichia coli strains deficient in spermidine acetyltransferase (an enzyme that metabolizes spermidine), accumulation of spermidine is greatly diminished in parallel with recovery of cell viability . Direct measurement of spermidine excretion using radiolabeled [14C]spermidine further confirms that the MdtJI complex actively exports spermidine from cells, with significantly increased levels of spermidine detected in the extracellular medium when the complex is expressed . This coordinated function highlights the evolutionary adaptation of bacteria to maintain polyamine homeostasis through specialized transport systems.

How is MdtJ expression regulated in bacterial cells?

The expression of mdtJ and mdtI genes is regulated in response to intracellular polyamine levels, particularly spermidine. Research has demonstrated that the level of mdtJI mRNA increases when cells are exposed to elevated spermidine concentrations, indicating a transcriptional response mechanism that helps mitigate potential toxicity . This regulation enables bacteria to dynamically adjust their spermidine export capacity based on cellular needs and environmental conditions.

The regulatory mechanisms likely involve specific transcription factors or regulatory RNAs that can sense changes in polyamine concentrations or cellular stress responses associated with polyamine imbalance. While the precise molecular mechanisms of this regulation are still being elucidated, the observed spermidine-dependent increase in mdtJI expression suggests the presence of polyamine-responsive regulatory elements in the promoter region of these genes. Understanding these regulatory mechanisms is crucial for comprehending how bacterial cells maintain polyamine homeostasis across different growth conditions and environmental challenges.

What experimental approaches are used to study MdtJ function in Shigella dysenteriae?

Several complementary experimental approaches are employed to investigate MdtJ function, beginning with genetic manipulation techniques. Researchers typically create knockout strains (mdtJ::Kmr) and complementation systems using expression vectors like pUC or pMW carrying the mdtJI genes . These genetic systems allow for the assessment of protein function through phenotypic analysis, particularly focusing on cell viability and growth in the presence of high spermidine concentrations. Viability assays comparing wild-type, knockout, and complemented strains provide critical insights into the protein's role in spermidine tolerance.

Transport activity of the MdtJI complex is directly measured using radiolabeled spermidine ([14C]spermidine) to track its movement across the cell membrane. In these experiments, cells are loaded with radiolabeled spermidine, and excretion is monitored by measuring the decreasing intracellular radioactivity and increasing extracellular radioactivity over time . High-performance liquid chromatography (HPLC) offers an alternative method for quantifying polyamine content in both intracellular and extracellular compartments, providing detailed profiles of polyamine distribution. Additionally, site-directed mutagenesis targeting specific amino acid residues (such as Tyr 4, Trp 5, Glu 15 in MdtJ) followed by functional assays helps identify critical residues involved in substrate recognition and transport .

For structural studies, recombinant protein expression systems are developed using various tags (such as HA tags) to facilitate purification and detection . Western blotting with tag-specific or protein-specific antibodies confirms successful expression, while protein purification techniques including affinity chromatography enable isolation of the protein for biochemical and structural analyses. Advanced structural biology techniques like X-ray crystallography or cryo-electron microscopy may be employed to determine the three-dimensional structure of the MdtJI complex, although membrane protein crystallization presents significant technical challenges.

What is the structural basis for spermidine recognition by the MdtJI complex?

The structural basis for spermidine recognition by the MdtJI complex involves specific amino acid residues that create a suitable binding pocket for this positively charged polyamine. Mutational analyses have identified six critical residues in MdtJ (Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82) and five in MdtI (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) that are essential for the complex's transport activity . The presence of negatively charged residues (glutamate and aspartate) likely facilitates electrostatic interactions with the positively charged amino groups of spermidine, while aromatic residues (tryptophan and tyrosine) may engage in cation-π interactions and contribute to the structural integrity of the binding site.

As members of the small multidrug resistance (SMR) family, MdtJ and MdtI are predicted to have four transmembrane helices each, which assemble to form a transport channel across the membrane . The amino acid sequence of MdtI (MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSQAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLT) provides insights into its hydrophobic nature and potential membrane topology . The spatial arrangement of the identified critical residues likely creates a pathway that guides spermidine through the membrane, with conformational changes facilitating the transport process.

While complete high-resolution structural data for the MdtJI complex remains limited, computational approaches including homology modeling based on related transporters and molecular dynamics simulations can generate testable hypotheses about the transport mechanism. The functional requirement for both MdtJ and MdtI suggests that the heterodimeric arrangement creates a unique configuration optimized for spermidine recognition and transport that neither protein can achieve individually . This structural specificity explains the complex's ability to discriminate between different polyamines and other potential substrates.

How do specific amino acid mutations affect MdtJ transport activity?

Site-directed mutagenesis studies have revealed that specific amino acid residues in MdtJ play crucial roles in its transport function. Mutations of Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 significantly impair the spermidine export activity of the MdtJI complex . These effects can be quantified through functional assays that measure cell viability in the presence of high spermidine concentrations or direct measurements of spermidine transport. The severity of functional impairment varies depending on the specific residue and the nature of the substitution, providing insights into the relative importance of each position for transport activity.

The distribution of critical residues throughout the protein sequence suggests they contribute to different aspects of the transport mechanism. Negatively charged residues like Glu 15 and Glu 82 likely participate in electrostatic interactions with the positively charged spermidine molecule, facilitating substrate recognition and binding . Aromatic residues such as Tyr 4, Trp 5, Tyr 45, and Tyr 61 may contribute to the structural architecture of the transport pathway or engage in cation-π interactions with spermidine. Conservative substitutions (maintaining similar chemical properties) typically produce milder effects than non-conservative changes, highlighting the importance of both the specific chemical properties and the precise positioning of these residues.

Beyond individual residue effects, the cumulative impact of multiple mutations can reveal cooperative interactions between different regions of the protein. Such combinatorial mutagenesis approaches help map the complete transport pathway and identify potential allosteric sites that influence transport activity without directly contacting the substrate. Analysis of the corresponding residues in MdtI (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) reveals similar patterns of charge distribution and aromatic positioning, suggesting a symmetrical or complementary arrangement of the binding site across the heterodimer interface .

What are the challenges in purifying functional recombinant MdtJ protein?

Purification of functional recombinant MdtJ presents several significant challenges inherent to membrane protein biochemistry. As an integral membrane protein with multiple transmembrane domains, MdtJ has highly hydrophobic regions that tend to aggregate when removed from the membrane environment. This hydrophobicity necessitates careful selection of detergents or membrane-mimetic systems that can maintain the protein in a soluble, properly folded state throughout the purification process. Different detergents (such as n-dodecyl-β-D-maltoside, digitonin, or lauryl maltose neopentyl glycol) must be systematically screened to identify optimal solubilization conditions that preserve functional integrity.

Expression systems must be carefully optimized to balance protein yield with proper folding and membrane insertion. While high-level expression is desirable for purification yields, overexpression of membrane proteins often leads to cellular stress, formation of inclusion bodies, or misfolding. E. coli BL21 strains are commonly used, but expression parameters including temperature, inducer concentration, and duration must be fine-tuned . Additionally, the functional dependence on MdtI complicates the purification strategy—whether to purify MdtJ alone or co-express and co-purify the entire MdtJI complex must be considered based on the specific research objectives.

Maintaining stability during purification represents another major challenge. Membrane proteins often lose activity rapidly once extracted from their native lipid environment. Supplementation with specific lipids or the use of nanodiscs or liposomes for reconstitution may be necessary to preserve function. For structural studies, protein tags (such as the HA tag mentioned in the research) facilitate purification but must be positioned to avoid interference with function . Assessment of purified protein functionality requires development of specialized assays that can measure transport activity in artificial membrane systems, such as proteoliposome-based transport assays or electrode-based electrophysiological methods.

How can recombinant MdtJ be used in studying polyamine transport mechanisms?

Recombinant MdtJ, particularly when expressed as part of the functional MdtJI complex, serves as a valuable model system for investigating fundamental mechanisms of polyamine transport across biological membranes. Reconstitution of purified recombinant MdtJI into proteoliposomes creates a defined system for measuring transport kinetics, substrate specificity, and the effects of membrane composition on transport activity. Such artificial membrane systems allow researchers to systematically vary conditions (pH, ionic strength, membrane potential) to determine their influence on transport rates and mechanisms, providing insights that are difficult to obtain in complex cellular environments.

Competition assays using structurally related polyamines (putrescine, spermine) or polyamine analogs help define the substrate recognition profile of the MdtJI complex and identify key molecular features required for transport . Comparison of transport activities between wild-type and mutant proteins in these defined systems enables precise mapping of structure-function relationships without confounding cellular factors. Additionally, recombinant MdtJ with site-specific incorporation of spectroscopic probes (fluorescent amino acids or spin labels) can reveal conformational changes associated with the transport cycle when analyzed using techniques such as fluorescence spectroscopy or electron paramagnetic resonance.

The recombinant protein also facilitates structural biology approaches. While membrane proteins present challenges for structural determination, advances in cryo-electron microscopy and X-ray crystallography of membrane proteins have improved the feasibility of obtaining high-resolution structural information. Such structural data, combined with functional assays using recombinant proteins, can provide comprehensive models of the transport mechanism at the molecular level. Furthermore, the MdtJI system offers an opportunity to study the evolutionary adaptation of transport proteins for specific substrates, particularly through comparative analysis with homologous proteins from other bacterial species.

What is the role of MdtJ in Shigella dysenteriae pathogenicity?

The connection between MdtJ function and Shigella dysenteriae pathogenicity involves its contribution to bacterial stress tolerance and survival in host environments. Shigella dysenteriae serotype 1 is particularly notable as the only serotype that produces Shiga toxin, capable of causing severe clinical disease including hemolytic uremic syndrome . While direct evidence linking MdtJ to virulence mechanisms remains limited, its role in polyamine homeostasis likely contributes to bacterial fitness during infection. Polyamines are essential for optimal bacterial growth and stress resistance, and appropriate regulation of their intracellular concentrations through transporters like MdtJ may enhance bacterial survival within the challenging host environment.

During intestinal infection, Shigella encounters various stressors including antimicrobial peptides, oxidative species, and pH fluctuations. The ability to maintain polyamine homeostasis through regulated import and export likely contributes to stress tolerance mechanisms. Additionally, host cells actively modulate polyamine levels as part of their defense strategies, potentially creating scenarios where bacterial polyamine export becomes crucial for survival. The spermidine export function of MdtJI might therefore represent an adaptation that helps Shigella dysenteriae counteract host defense mechanisms targeting polyamine metabolism.

Research approaches to investigate these connections include creating mdtJ knockout strains of Shigella dysenteriae and assessing their virulence in cellular and animal infection models . Transcriptomic analyses comparing mdtJ expression levels during different stages of infection can reveal whether this transporter is specifically upregulated during host colonization. Combining these approaches with studies of host polyamine responses during infection could provide a comprehensive understanding of how polyamine transport systems like MdtJI contribute to the complex host-pathogen interactions that characterize Shigella infections.

How does the MdtJI complex compare to other bacterial polyamine transporters?

The MdtJI complex represents a distinct class of polyamine transporters with several unique characteristics compared to other bacterial polyamine transport systems. Unlike the well-characterized PotE and CadB transporters, which function as putrescine/cadaverine exchangers that export these polyamines only at acidic pH and import them at neutral pH, the MdtJI complex specifically exports spermidine and functions effectively at neutral pH . This fundamental difference in pH dependence and substrate specificity suggests divergent evolutionary adaptations for different physiological roles.

Structurally, the MdtJI complex belongs to the small multidrug resistance (SMR) family, characterized by proteins with approximately 100-140 amino acids organized into four transmembrane segments . This contrasts with other polyamine transporters like the PotABCD spermidine uptake system, which belongs to the ATP-binding cassette (ABC) transporter superfamily and utilizes ATP hydrolysis to drive transport. The MdtJI complex likely uses an ion gradient rather than ATP as its energy source, representing a more energy-efficient transport mechanism particularly valuable under stress conditions where ATP conservation is crucial.

Comparative genomic analyses reveal that mdtJI homologs are present across diverse bacterial species but show variations in sequence conservation and genomic organization. The table below summarizes key differences between major bacterial polyamine transport systems:

Transport SystemFamilyDirectionSubstrate SpecificityEnergy SourcepH Dependence
MdtJISMRExportSpermidineIon gradient (presumed)Active at neutral pH
PotEAPCImport/ExportPutrescineH+ antiportExport at acidic pH, import at neutral pH
CadBAPCImport/ExportCadaverineH+ antiportExport at acidic pH, import at neutral pH
PotABCDABCImportSpermidine, PutrescineATP hydrolysisActive at various pH

This diversity in transport mechanisms reflects the evolutionary importance of precise polyamine regulation in bacterial physiology. Understanding these differences provides insights into how bacteria have developed specialized systems for maintaining polyamine homeostasis across diverse environmental conditions and physiological states.

What are the optimal conditions for expressing recombinant MdtJ protein?

Successful expression of recombinant MdtJ protein requires careful optimization of multiple parameters to balance protein yield with proper folding and membrane insertion. E. coli BL21(DE3) or its derivatives are commonly used as expression hosts due to their reduced protease activity and compatibility with T7 promoter-based expression systems . For membrane proteins like MdtJ, lower expression temperatures (16-25°C rather than 37°C) often improve proper folding by slowing the expression rate and allowing more time for membrane insertion. Similarly, induction with lower concentrations of IPTG (0.1-0.5 mM) typically yields better results than standard concentrations (1 mM).

Expression vectors significantly impact recombinant protein quality and quantity. While high-copy-number vectors like pUC can produce greater protein yields, they may lead to excessive expression that overwhelms the membrane insertion machinery . Medium or low-copy-number vectors like pMW119 often provide a better balance between expression level and proper localization. Including a fusion tag (such as His6, FLAG, or HA) facilitates detection and purification, though the tag position (N-terminal vs. C-terminal) should be empirically determined to minimize functional interference .

The growth medium composition and culture conditions also influence expression outcomes. Rich media (like LB or 2xYT) support higher cell densities but may result in lower per-cell expression, while minimal media with controlled carbon sources can enhance the proportion of properly folded protein. For particularly challenging membrane proteins, specialized expression systems including cell-free translation in the presence of detergents or lipids, or expression in eukaryotic systems like yeast, insect cells, or mammalian cells, may be considered. Each system offers different advantages in terms of post-translational modifications, membrane composition, and protein folding machinery.

What methods are effective for detecting and quantifying spermidine transport activity?

Several complementary methods can effectively measure spermidine transport activity of the MdtJI complex, each with specific advantages for different experimental questions. Radioisotope-based assays using [14C]spermidine provide direct, sensitive measurements of transport kinetics . In these assays, cells expressing MdtJI are loaded with radiolabeled spermidine, and the decrease in intracellular radioactivity over time indicates export activity. Simultaneously, measuring the appearance of radioactivity in the extracellular medium confirms that the spermidine is being actively transported rather than leaking through damaged membranes . This approach allows precise quantification of transport rates and can be adapted to various experimental conditions.

HPLC-based methods offer an alternative approach that doesn't require radioactive materials. Cells are incubated with spermidine, and samples of both the intracellular contents and extracellular medium are collected at various time points. After derivatization with appropriate reagents (such as dansyl chloride or o-phthalaldehyde), polyamines can be separated by HPLC and quantified using fluorescence detection . This method allows simultaneous measurement of multiple polyamines, providing insights into substrate specificity and potential compensatory changes in other polyamine levels.

For more high-throughput approaches, indirect assays based on cell survival can be employed. Since spermidine overaccumulation is toxic to cells lacking spermidine acetyltransferase, the ability of MdtJI expression to restore growth in the presence of high spermidine concentrations serves as a functional readout of transport activity . This approach is particularly useful for screening multiple constructs or conditions but provides less detailed kinetic information than direct transport measurements. Growth curve analysis using plate readers allows quantitative comparison of different constructs based on parameters such as lag time, growth rate, and maximum cell density in the presence of spermidine challenge.

How do you design experiments to distinguish between MdtJ roles in multidrug resistance versus polyamine transport?

Designing experiments to differentiate between general multidrug resistance and specific polyamine transport functions of MdtJ requires systematic comparative analyses across multiple substrates and conditions. As a member of the small multidrug resistance (SMR) family, MdtJ might potentially transport various compounds beyond polyamines . Substrate specificity assays comparing transport rates or resistance levels across structurally diverse compounds (polyamines, antibiotics, dyes, detergents) can reveal the selectivity profile of the MdtJI complex. True multidrug transporters typically show broad substrate profiles, while dedicated polyamine transporters display higher specificity.

Competition assays provide another approach to this question. If MdtJI primarily functions as a spermidine exporter, then structurally related polyamines should competitively inhibit spermidine transport, while unrelated compounds would show minimal interference . In these experiments, radiolabeled spermidine transport is measured in the presence of increasing concentrations of unlabeled potential competitors. The pattern of inhibition across different molecules reveals the structural requirements for recognition by the transport system and distinguishes between specific and promiscuous transporters.

Molecular approaches using site-directed mutagenesis of specific residues can further differentiate between these functions. Mutations targeting the identified critical residues in MdtJ (Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82) would be expected to primarily affect polyamine transport if these residues form a specific spermidine-binding site . In contrast, if MdtJ functions as a general multidrug transporter, mutations affecting the central transport channel might impair transport of all substrates similarly. By correlating the effects of specific mutations on transport of spermidine versus potential alternative substrates, researchers can determine whether the molecular recognition mechanisms are shared or distinct.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.