Recombinant Shigella dysenteriae serotype 1 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Overview of YedZ in Shigella dysenteriae Serotype 1

YedZ is a flavocytochrome involved in sulfoxide reduction, a process essential for detoxifying reactive oxygen species (ROS) during bacterial infection . In Shigella, this enzyme supports survival under host-induced oxidative stress, enabling colonization of the colonic mucosa . The recombinant form is produced using Escherichia coli expression systems with an N-terminal His-tag for purification .

Table 1: Comparative Features of Recombinant YedZ Across Shigella Species

SpeciesUniProt IDLength (aa)Expression HostTag
S. dysenteriae (inferred)N/A211E. coliHis-tag
S. flexneriQ0T3F9211E. coliHis-tag
S. sonneiQ3Z0L7211E. coliHis-tag

Recombinant Production and Purification

Recombinant YedZ is synthesized via plasmid-based expression in E. coli, followed by affinity chromatography (e.g., Ni-NTA for His-tag purification) . Key parameters include:

  • Yield: ~0.57 mg/mL (similar to recombinant IpaD in S. dysenteriae) .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

  • Purity: >90% confirmed by SDS-PAGE .

Functional Insights from Homologous Systems

While S. dysenteriae YedZ has not been directly characterized, studies on related proteins reveal:

  • Role in Oxidative Stress: YedZ homologs in S. flexneri and S. sonnei mitigate host-derived ROS, enhancing bacterial survival in inflamed tissues .

  • Metabolic Adaptation: Upregulated during anaerobic conditions in vivo, suggesting a role in energy metabolism under host stress .

  • Interaction with Virulence Pathways: Co-expressed with T3SS effectors (e.g., IpaC, IpaD), which facilitate epithelial invasion .

Antibiotic Resistance Studies

YedZ’s contribution to redox balance may explain its indirect role in antibiotic tolerance. S. dysenteriae strains with upregulated oxidative stress responses show increased survival against β-lactams .

Vaccine Development

Although YedZ is not yet a validated vaccine target, recombinant proteins like IpaD have shown promise in eliciting immune responses . YedZ’s surface accessibility and conservation make it a potential candidate for future studies .

Challenges and Future Directions

  • Functional Characterization: Direct studies on S. dysenteriae YedZ are needed to confirm its role in virulence.

  • Structural Analysis: Cryo-EM or X-ray crystallography could elucidate substrate-binding mechanisms.

  • Therapeutic Targeting: Inhibitors of YedZ could disrupt redox homeostasis, offering a novel antibacterial strategy .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msrQ; SDY_1034; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
msrQ
Target Protein Sequence
MRLTAKQVTWLKVCLHLAGLLPFLWLVWAINHGGLGADPVKDIQHFTGRTALKFLLATLL ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYA GLAVLLLALRYKKLRSLFNRLRKQVHNKLSV
Uniprot No.

Target Background

Function

YedZ is a component of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This protects these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing various structurally diverse periplasmic proteins from methionine oxidation, including the essential periplasmic chaperone SurA and the lipoprotein Pal. MsrQ facilitates electron reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.

Database Links

KEGG: sdy:SDY_1034

Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YedZ and why was it renamed to MsrQ?

YedZ is an integral membrane protein that has been renamed to MsrQ following the discovery of its functional role. Initially, YedZ was identified as a protein of unknown function in Escherichia coli with six transmembrane spanning (TMS) domains. The protein was renamed to MsrQ after researchers established its role in the MsrPQ methionine sulfoxide reductase system, where it functions as the specific electron donor for MsrP (previously known as YedY) . This nomenclature change reflects the shift from a position-based naming convention to a function-based one, which is common in bacterial genetics once a protein's role is characterized.

What is the structural composition of the MsrQ protein?

MsrQ (formerly YedZ) is an integral membrane protein with six transmembrane spanning (TMS) domains. The protein contains two b-type heme cofactors that are critical for its electron transfer function. Structural analysis reveals conserved histidyl residues in the transmembrane domains that are involved in heme binding . Specifically, one heme-binding site involves His-164 and likely His-91, similar to what has been reported for NADPH oxidase (NOX) enzymes. The second heme has an atypical coordination, with His-151 involved but missing the second canonical heme binding histidine in the third transmembrane helix . The protein appears to have evolved through an intragenic triplication of a 2 TMS-encoding element, resulting in its current 6-TMS structure .

How does the MsrPQ system function in bacterial cells?

The MsrPQ system represents a newly identified methionine sulfoxide reductase system in bacteria that repairs periplasmic proteins oxidized by hypochlorous acid. This system consists of two proteins working in concert:

  • MsrP (formerly YedY): A periplasmic soluble protein containing a molybdenum atom in its active site that performs the methionine sulfoxide reductase activity.

  • MsrQ (formerly YedZ): An integral membrane b-type heme-containing protein that serves as the specific electron donor for MsrP .

The system operates with MsrQ transferring electrons across the membrane to MsrP, which then catalyzes the reduction of methionine sulfoxide residues in oxidized periplasmic proteins. This repair mechanism is particularly important for bacterial survival under oxidative stress conditions, such as those encountered during host immune responses .

How is recombinant MsrQ protein typically expressed and purified for biochemical studies?

Expression and purification of recombinant MsrQ protein for biochemical studies typically follows these methodological steps:

  • Gene Cloning and Vector Construction:

    • The gene encoding MsrQ is amplified from Shigella dysenteriae genomic DNA

    • The gene is sub-cloned into an appropriate expression vector (e.g., pET28a)

    • The resulting construct should include a tag (often His-tag) to facilitate purification

  • Transformation and Expression:

    • The recombinant plasmid is transformed into a suitable E. coli expression strain (e.g., Rosetta DE3)

    • Expression is induced under optimized conditions that ensure proper incorporation of heme cofactors

    • For membrane proteins like MsrQ, expression conditions must be carefully controlled to prevent inclusion body formation

  • Protein Purification:

    • Cell disruption is performed under conditions that preserve membrane protein integrity

    • Membrane fractions are isolated by ultracentrifugation

    • The protein is solubilized using appropriate detergents

    • Affinity chromatography (typically Ni-NTA for His-tagged proteins) is used for initial purification

    • Further purification may involve ion exchange chromatography and gel filtration

  • Validation:

    • Western blotting with anti-histidine monoclonal antibody confirms the identity

    • Spectroscopic analysis confirms proper heme incorporation

    • Functional assays assess electron transfer capability

The yield of purified protein varies depending on expression conditions, but researchers should optimize to achieve sufficient quantities for subsequent biochemical and structural studies.

What are the recommended methods for assessing MsrQ heme incorporation and binding?

Assessment of heme incorporation and binding in recombinant MsrQ involves multiple complementary techniques:

These methods collectively provide a comprehensive assessment of proper heme incorporation, which is critical for MsrQ function as an electron donor to MsrP .

How can researchers effectively analyze the interaction between MsrP and MsrQ?

To effectively analyze the interaction between MsrP and MsrQ, researchers can employ the following methodological approaches:

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged versions of both proteins (different tags for each)

    • Use antibodies against one tag to precipitate the complex

    • Analyze the precipitate for the presence of the partner protein

    • This confirms physical interaction in vitro

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MsrP on a sensor chip

    • Flow solutions containing MsrQ at different concentrations

    • Measure binding kinetics and determine affinity constants

    • Analysis of binding in the presence/absence of heme can reveal cofactor requirements

  • Microscale Thermophoresis (MST):

    • Label one protein partner (typically the soluble MsrP)

    • Titrate with increasing concentrations of the unlabeled partner

    • Measure changes in thermophoretic mobility to determine binding affinity

  • Bacterial Two-Hybrid Assays:

    • Create fusion constructs of MsrP and MsrQ with complementary fragments of a reporter protein

    • Transform into bacterial cells and measure reporter activity

    • This approach allows for analysis of interactions in a cellular context

  • Electron Transfer Assays:

    • Reconstitute the MsrPQ system in liposomes

    • Add electron donors (like NADH) and measure reduction of methionine sulfoxide substrates

    • Compare activity with intact system versus individual components

    • Use site-directed mutants to identify critical residues for interaction

  • Cryo-Electron Microscopy:

    • For structural analysis of the complete membrane-associated complex

    • Provides insights into the interaction interface between the proteins

These techniques provide complementary information about both the physical interaction and functional coupling between MsrP and MsrQ in the methionine sulfoxide reductase system .

How does the expression of MsrQ differ between various infection sites in Shigella dysenteriae?

Shigella dysenteriae exhibits differential gene expression based on its infection site, which affects the expression of proteins including MsrQ. Based on transcriptomic analysis of clinical isolates:

  • Intestinal (Primary) Infection Site:

    • In stool samples, genes involved in invasion and virulence typically show higher expression

    • The oxidative stress response system, including MsrQ expression, is modulated to counter host-derived reactive oxygen species

    • Expression of membrane proteins like MsrQ may be upregulated to maintain cell envelope integrity under stress conditions

  • Bloodstream Infection (Bacteremia):

    • When S. dysenteriae enters the bloodstream, it encounters different environmental stresses

    • Transcriptomic data shows altered expression patterns of stress response genes

    • The MsrPQ system may be differentially regulated to adapt to this environment

  • Gene Expression Pattern Comparison:

    Infection SiteMsrQ ExpressionAssociated Stress Response GenesVirulence Factors
    IntestinalModerate to highOxidative stress genes activatedHigher expression of invasion genes
    BloodstreamVariableShift to different stress responsesModified expression pattern
  • Regulatory Mechanisms:

    • Transcriptional regulation via environmental sensing systems

    • Post-transcriptional control through sRNAs

    • Protein stability changes in different environments

The differential protein expression observed in S. dysenteriae demonstrates its specific response to particular intracellular environments, which likely extends to the regulation of MsrQ expression . This adaptability helps the bacterium survive in diverse host environments during infection progression.

What are the structural and functional differences between MsrQ in Shigella dysenteriae and its homologues in other bacteria?

MsrQ (YedZ) homologues exist across different bacterial species with varying structural and functional characteristics:

  • Transmembrane Domain Organization:

    • Shigella and E. coli MsrQ proteins contain six transmembrane spanning (TMS) domains

    • These appear to have evolved through intragenic triplication of a 2 TMS-encoding element

    • Some bacterial homologues may have variations in the number or arrangement of TMS domains

  • Heme-Binding Sites:

    • Conserved histidyl residues in transmembrane domains are common across species

    • The coordination of heme cofactors shows species-specific variations

    • In E. coli, one heme-binding site involves His-164 and His-91, with His-151 involved in coordinating the second heme

    • Variations in these residues may affect electron transfer properties

  • Domain Fusions in Different Bacteria:

    • In magnetotactic bacteria, YedZ domains are fused to transport proteins

    • In cyanobacteria, YedZ domains are fused to electron transfer proteins

    • These fusion proteins suggest specialized functions in different bacterial species

  • Sequence Conservation:

    SpeciesSequence Identity to S. dysenteriae MsrQKey Structural DifferencesFunctional Implications
    E. coliVery high (>90%)Minimal differencesSimilar function
    Magnetotactic bacteriaModerateDomain fusions with transport proteinsModified functionality
    CyanobacteriaModerateDomain fusions with electron transfer proteinsSpecialized electron transport
  • Phylogenetic Distribution:

    • YedZ homologues are identified in bacteria and animals

    • Notably absent in Archaea and other eukaryotic kingdoms

    • This distribution pattern suggests specific evolutionary pathways

These differences highlight how the basic MsrQ scaffold has been adapted across bacterial species for specialized functions while maintaining the core heme-binding and electron transfer capabilities.

What is the role of MsrQ in Shigella dysenteriae pathogenesis and virulence?

The role of MsrQ in Shigella dysenteriae pathogenesis involves several interconnected mechanisms:

  • Protection Against Oxidative Stress:

    • As part of the MsrPQ system, MsrQ helps repair oxidized periplasmic proteins

    • This is crucial during infection as host cells generate reactive oxygen species (ROS) and hypochlorous acid as antimicrobial defenses

    • By maintaining functional periplasmic proteins, MsrQ contributes to bacterial survival under oxidative stress

  • Maintenance of Membrane Integrity:

    • As a membrane protein with electron transfer capabilities, MsrQ helps maintain redox homeostasis

    • This contributes to membrane integrity during host-pathogen interactions

    • Membrane integrity is essential for virulence factor secretion and host cell invasion

  • Potential Regulation of Virulence Factors:

    • Differential gene expression studies show that invasion genes are highly expressed at the primary site of infection

    • The redox status of the bacterium, influenced by systems like MsrPQ, may modulate virulence factor expression

    • The electron transfer function of MsrQ might indirectly affect signaling pathways controlling virulence

  • Contribution to Persistent Infection:

    • By repairing oxidized proteins, MsrQ may contribute to bacterial persistence

    • This is particularly relevant for Shigella's ability to survive within host cells

    • Extended survival increases opportunities for spreading to new infection sites

  • Interaction with Host Defense Mechanisms:

    • The MsrPQ system represents a bacterial adaptation to host-derived oxidants

    • This system may be particularly important when S. dysenteriae transitions from intestinal infection to bloodstream invasion

    • Its function may contribute to the bacterium's ability to cause extra-intestinal complications like bacteremia

While direct experimental evidence specifically linking MsrQ to virulence in S. dysenteriae is limited, its role in the MsrPQ system strongly suggests it contributes to pathogenesis through protection against host-derived oxidative stress and maintenance of bacterial physiology during infection.

How does the MsrPQ system compare with other bacterial methionine sulfoxide reductase systems?

Bacteria possess multiple methionine sulfoxide reductase (Msr) systems, with MsrPQ representing a recently discovered variant. Here's a comparative analysis:

  • Cytoplasmic MsrA/MsrB System:

    • Traditional system found in most bacteria

    • MsrA reduces S-epimers of methionine sulfoxide

    • MsrB reduces R-epimers of methionine sulfoxide

    • Uses thioredoxin as electron donor

    • Located in cytoplasm, protecting cytoplasmic proteins

  • MsrPQ System:

    • More recently characterized system

    • MsrP (formerly YedY) contains molybdenum cofactor in active site

    • MsrQ (formerly YedZ) is an integral membrane heme-containing protein

    • Specifically repairs periplasmic proteins oxidized by hypochlorous acid

    • Located in/across the membrane, protecting periplasmic space

  • Comparative Characteristics:

    FeatureMsrA/MsrB SystemMsrPQ System
    CofactorsThiol groupsMolybdenum (MsrP), Heme (MsrQ)
    Electron sourceThioredoxinMembrane-derived via MsrQ
    Cellular locationCytoplasmPeriplasm/Membrane
    Target specificityGeneral MetO reductionFocus on HOCl-oxidized proteins
    StereospecificityMsrA: S-epimer, MsrB: R-epimerLess stereospecific
  • Evolutionary Considerations:

    • MsrA/MsrB system is widespread across all domains of life

    • MsrPQ appears more specialized, found in a subset of bacteria

    • May represent an adaptation to specific environmental niches or host interactions

    • YedZ homologues show specific phylogenetic distribution (bacteria and animals)

  • Functional Complementarity:

    • The systems appear to complement each other in spatial coverage

    • Together they provide protection for both cytoplasmic and periplasmic proteins

    • This dual system may be particularly important for gram-negative bacteria facing diverse oxidative stresses

This comparative analysis highlights how bacteria have evolved multiple, complementary systems to protect against methionine oxidation in different cellular compartments and under different stress conditions.

What connections exist between bacterial MsrQ and eukaryotic heme-binding proteins?

The relationships between bacterial MsrQ and eukaryotic heme-binding proteins reveal interesting evolutionary and functional connections:

  • Structural Similarities with NADPH Oxidase (NOX):

    • MsrQ belongs to the FRD superfamily of heme-containing membrane proteins, which includes eukaryotic NOX/DUOX proteins

    • The first heme-binding site in MsrQ involves His-164 and His-91, similar to arrangements in NOX enzymes

    • Both systems use heme cofactors for electron transfer across membranes

  • Animal Homologues of YedZ/MsrQ:

    • YedZ homologues have been identified in animals but not in other eukaryotic kingdoms

    • One notable animal homologue is the 6 TMS epithelial plasma membrane antigen of the prostate (STAMP1), which is overexpressed in prostate cancer

    • Animal homologues have YedZ domains fused C-terminal to homologues of coenzyme F420-dependent NADP oxidoreductases

  • Domain Architecture Comparisons:

    ProteinDomain ArchitectureHeme Binding MotifsFunctional Role
    Bacterial MsrQ6 TMS with heme-binding sitesConserved histidines in TMSElectron donor to MsrP
    Animal STAMP1YedZ-like domain + additional domainsSimilar to bacterial counterpartsCell signaling, potential role in cancer
    NOX enzymesMembrane domain + cytosolic domainsSimilar heme coordinationROS generation
  • Functional Divergence:

    • Bacterial MsrQ: Involved in protein repair systems

    • Eukaryotic NOX: Primarily generates ROS for signaling and defense

    • This represents an interesting functional divergence while maintaining structural similarities

  • Evolutionary Implications:

    • The presence of YedZ homologues in animals but not other eukaryotes suggests specific evolutionary events

    • Potentially represents lateral gene transfer events at some point in evolutionary history

    • Alternatively could indicate convergent evolution of similar structures

These connections provide insights into the evolutionary relationships between bacterial and eukaryotic electron transfer systems and suggest that similar structural solutions have evolved for different functional needs across diverse organisms.

What are the major technical challenges in expressing and studying recombinant MsrQ?

Researchers face several significant technical challenges when expressing and studying recombinant MsrQ:

  • Membrane Protein Expression Difficulties:

    • As an integral membrane protein with 6 transmembrane domains, MsrQ is inherently challenging to express in recombinant systems

    • Tendency to form inclusion bodies when overexpressed

    • Proper folding and insertion into membranes requires optimization of expression conditions

    • Selection of appropriate detergents for solubilization without disrupting structure

  • Heme Incorporation Issues:

    • Ensuring proper incorporation of two b-type heme cofactors

    • May require supplementation of growth media with heme precursors

    • Incomplete heme incorporation leads to non-functional protein

    • Challenges in distinguishing between the two heme environments during spectroscopic analysis

  • Purification Challenges:

    • Maintaining membrane protein stability during extraction and purification

    • Detergent selection critical for preserving native structure and function

    • Potential loss of heme cofactors during purification procedures

    • Limited yield compared to soluble proteins (~0.5-0.6 mg/ml is typical for similar membrane proteins)

  • Structural Analysis Limitations:

    • Difficulty in obtaining crystals for X-ray crystallography

    • Challenges in applying traditional NMR techniques due to size and membrane environment

    • Need for specialized approaches like cryo-electron microscopy or solid-state NMR

    • Limited structural information hampers understanding of precise electron transfer mechanisms

  • Functional Reconstitution:

    • Reconstituting the complete MsrPQ system in vitro requires both membrane protein (MsrQ) and soluble component (MsrP)

    • Creating a functional system that mimics the native membrane arrangement

    • Developing reliable assays to measure electron transfer activities

These technical challenges explain why comprehensive structural and mechanistic understanding of MsrQ has lagged behind that of the soluble component MsrP, which has been structurally well-characterized .

What potential applications exist for engineered variants of MsrQ in biotechnology?

Engineered variants of MsrQ hold promise for several biotechnological applications:

  • Oxidative Stress Protection in Industrial Microorganisms:

    • Engineered MsrQ variants could enhance oxidative stress resistance in industrial strains

    • Applications in biofuel production, where oxidative stress limits productivity

    • Potential to improve yields in biopharmaceutical production using bacterial systems

  • Biosensor Development:

    • MsrQ's heme-binding properties and electron transfer capabilities make it suitable for biosensor applications

    • Engineered variants could detect specific oxidants or redox-active compounds

    • Potential integration into electrochemical detection systems for environmental monitoring

  • Vaccine Development:

    • Similar to other bacterial membrane proteins, engineered MsrQ variants could serve as vaccine components

    • The approach demonstrated with IpaD protein from Shigella could be applied to MsrQ

    • Recombinant production methods developed for IpaD could be adapted for MsrQ

  • Protein Engineering Applications:

    Engineering TargetPotential ModificationBiotechnological Application
    Heme-binding sitesModified histidine positionsAltered electron transfer properties
    Transmembrane domainsChimeric constructs with other proteinsNovel membrane-anchored biocatalysts
    Substrate specificityModifications to interaction surfaceTargeted protection of valuable proteins
  • Drug Delivery Systems:

    • Modified MsrQ could be incorporated into liposomes or nanoparticles

    • Could potentially serve as an anchor for membrane-based drug delivery systems

    • Electron transfer capabilities might be harnessed for triggered release mechanisms

  • Bioremediation Applications:

    • Engineered MsrQ variants might detoxify specific environmental contaminants

    • Integration into membrane systems for water treatment applications

    • Potential for removing or transforming redox-active pollutants

These applications would build upon the fundamental understanding of MsrQ structure and function, applying the protein's unique properties to address biotechnological challenges.

What methodological approaches can address the contradictory findings in MsrQ research?

To address contradictory findings in MsrQ research, several methodological approaches should be considered:

By systematically applying these methodological approaches, researchers can resolve contradictions and develop a more coherent understanding of MsrQ structure, function, and physiological roles in Shigella dysenteriae and other bacterial systems.

What are the most promising future research directions for understanding MsrQ in bacterial pathogenesis?

Several promising research directions can advance our understanding of MsrQ in bacterial pathogenesis:

  • Structural Biology Advancements:

    • Determining high-resolution structures of the complete MsrPQ complex

    • Using cryo-electron microscopy to visualize the membrane-embedded state

    • Understanding conformational changes during electron transfer

    • These structural insights would clarify the molecular basis of function

  • Systems Biology Approaches:

    • Integrating transcriptomics, proteomics, and metabolomics

    • Mapping the complete redox response network during infection

    • Identifying regulatory connections between MsrPQ and virulence systems

    • Understanding how differential gene expression affects MsrQ function at different infection sites

  • Host-Pathogen Interaction Studies:

    • Investigating how host-derived oxidants specifically affect MsrQ function

    • Determining whether MsrQ is a target of host immune responses

    • Assessing the role of MsrQ in bacterial survival within different host cell types

    • These studies would clarify the protein's role during actual infection processes

  • Comparative Genomics and Evolution:

    • Comprehensive analysis of MsrQ across bacterial pathogens

    • Connecting sequence variations to functional differences

    • Understanding selective pressures that have shaped MsrQ evolution

    • These approaches could reveal why this system has been maintained in pathogenic bacteria

  • Therapeutic Target Exploration:

    • Assessing MsrQ as a potential antibiotic target

    • Developing specific inhibitors of the MsrPQ system

    • Testing whether MsrQ inhibition sensitizes bacteria to host defenses

    • This could open new avenues for antimicrobial development

These research directions collectively would provide a comprehensive understanding of how MsrQ contributes to bacterial pathogenesis and could potentially lead to new therapeutic strategies against Shigella dysenteriae and related pathogens.

How might recent technological advances improve our understanding of MsrQ function?

Recent technological advances offer significant opportunities to enhance our understanding of MsrQ function:

  • Cryo-Electron Microscopy Advancements:

    • Latest detectors and processing algorithms allow near-atomic resolution of membrane proteins

    • Can visualize MsrQ in its native membrane environment

    • Potential to capture different conformational states during electron transfer

    • May resolve current structural uncertainties about heme coordination

  • Single-Molecule Techniques:

    • Single-molecule FRET to monitor protein dynamics and conformational changes

    • Optical tweezers or atomic force microscopy to study protein-protein interactions

    • These approaches can reveal heterogeneity masked in ensemble measurements

  • Advanced Mass Spectrometry:

    • Hydrogen-deuterium exchange mass spectrometry to map protein interaction surfaces

    • Crosslinking mass spectrometry to identify specific contact residues between MsrP and MsrQ

    • Native mass spectrometry to determine stoichiometry of the complete complex

  • CRISPR-Based Methods:

    • CRISPR interference for precise transcriptional control in native context

    • Base editing for introducing specific mutations without selection markers

    • CRISPRi screens to identify genetic interactions with msrQ

    • These methods allow more precise genetic manipulation than traditional approaches

  • In-Cell Structural Biology:

    • In-cell NMR to study protein structure in the cellular environment

    • Electron tomography to visualize protein complexes in situ

    • These approaches bridge the gap between in vitro biochemistry and cellular function

  • Computational Advances:

    • Molecular dynamics simulations of membrane-embedded MsrQ

    • Machine learning approaches to predict protein-protein interactions

    • Quantum mechanics/molecular mechanics calculations for electron transfer mechanisms

    • These computational methods can address questions difficult to approach experimentally

  • Technological Impact Assessment:

    TechnologyApplication to MsrQ ResearchPotential Breakthrough
    AlphaFold2/RoseTTAFoldPrediction of full MsrQ structureImproved structural models without crystallization
    Nanopore sequencingDirect RNA sequencing under infection conditionsReal-time transcriptional response profiling
    MicrofluidicsSingle-cell analysis of bacterial responsesCell-to-cell variation in MsrQ function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.