Recombinant Shigella dysenteriae serotype 1 Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Characterization

Recombinant DsbD is produced in E. coli expression systems, enabling high yields for structural and functional studies.

Role in Bacterial Pathogenesis

DsbD is essential for maintaining redox balance in the periplasm, enabling:

  • Virulence Factor Maturation: Proper folding of type III secretion system (T3SS) effectors (e.g., IpaB, IpaC) .

  • Stress Adaptation: Survival under oxidative and acid stress conditions encountered in the host gut .

  • Antibiotic Resistance: Indirect contribution via stabilization of membrane transporters .

Comparative Insights:

  • In Shigella flexneri, homologs like DsbA are critical for T3SS effector secretion and cell-to-cell spread .

  • E. coli DsbD homologs facilitate disulfide bond isomerization in fimbrial adhesins and flagellar components .

Research Applications

  1. Vaccine Development:

    • DsbD’s role in virulence makes it a potential target for subunit vaccines. For example, truncated IpaD (a T3SS effector regulated by Dsb proteins) has shown promise as a vaccine candidate against Shigella .

  2. Antimicrobial Drug Design:

    • Inhibitors targeting DsbD could disrupt bacterial redox homeostasis, reducing pathogenicity .

  3. Structural Biology:

    • Recombinant DsbD enables crystallographic studies to map substrate-binding interfaces .

Challenges and Future Directions

  • Functional Redundancy: Shigella possesses multiple disulfide bond systems (e.g., DsbAB, DsbLI), complicating targeted inhibition .

  • Limited In Vivo Data: Most studies on DsbD are based on E. coli homologs; direct evidence in Shigella remains sparse .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributor for accurate delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
dsbD; SDY_4441; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-565
Protein Length
Full Length of Mature Protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADQAFTFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAAPQPVSVPQQEQPTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDIWGLRLWSALGVAFFGGAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP
Uniprot No.

Target Background

Function
DsbD plays a crucial role in facilitating the formation of correct disulfide bonds in certain periplasmic proteins, particularly in the assembly of periplasmic c-type cytochromes. It functions by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps.
Database Links

KEGG: sdy:SDY_4441

Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining DsbD protein stability?

For long-term storage, the recombinant DsbD protein should be stored at -20°C to -80°C. After receipt, it is recommended to aliquot the protein to avoid repeated freeze-thaw cycles which can compromise structural integrity. Working aliquots can be maintained at 4°C for up to one week. The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage .

What reconstitution protocols are recommended for lyophilized DsbD protein?

The recommended protocol for reconstitution includes:

  • Brief centrifugation of the vial prior to opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquoting for long-term storage at -20°C/-80°C

This approach helps maintain protein stability and prevents degradation during experimental use .

What expression systems are effective for recombinant DsbD production?

The most effective and commonly used expression system for recombinant DsbD is E. coli. When expressing the Shigella dysenteriae serotype 1 DsbD protein, the full-length mature protein (amino acids 20-565) is typically fused to an N-terminal His-tag to facilitate purification. This approach allows for high yield and purity (greater than 90% as determined by SDS-PAGE) . The E. coli system is preferred due to its simplicity, cost-effectiveness, and ability to produce substantial quantities of properly folded protein.

How can researchers optimize purification of recombinant DsbD?

Purification optimization for DsbD should focus on:

Purification StepKey ConsiderationsTroubleshooting
Cell LysisBuffer composition (typically Tris/PBS-based, pH 8.0)Inclusion of protease inhibitors to prevent degradation
Affinity ChromatographyNi-NTA resin binding for His-tagged proteinImidazole concentration optimization to reduce non-specific binding
Purity AssessmentSDS-PAGE analysis (target >90% purity)Western blot verification using anti-His antibodies
Buffer ExchangeRemoval of elution agentsDialysis or desalting columns
ConcentrationAvoiding protein aggregationCentrifugal concentrators with appropriate molecular weight cutoff
LyophilizationAddition of 6% trehalose as cryoprotectantControlled freezing prior to lyophilization

The purification process should be validated through multiple quality control steps, including SDS-PAGE analysis to confirm the expected molecular weight and purity exceeding 90% .

What assays can measure the thiol:disulfide interchange activity of DsbD?

Researchers can employ several complementary approaches to measure the thiol:disulfide interchange activity of DsbD:

  • Fluorescence-based assays: Using fluorescent thiol-reactive probes that change emission properties upon disulfide exchange.

  • Coupled enzyme assays: Monitoring NADPH consumption when DsbD activity is coupled to thioredoxin/thioredoxin reductase.

  • Mass spectrometry: Analyzing the modification state of cysteines within DsbD or substrate proteins before and after interaction.

  • Insulin precipitation assay: A classical approach where DsbD-mediated reduction of insulin disulfides leads to precipitation that can be monitored spectrophotometrically.

  • Modified SBA assay: Similar to serum bactericidal activity assays used for Shigella vaccine research, this can be adapted to evaluate how DsbD affects bacterial resistance to complement-mediated killing .

When designing these assays, researchers should consider:

  • pH dependence (typically optimal around pH 7.0-8.0)

  • Redox buffer composition

  • Temperature effects on reaction kinetics

  • Substrate specificity considerations

How does DsbD contribute to Shigella pathogenesis and virulence?

DsbD plays a critical role in Shigella pathogenesis through several mechanisms:

  • Maintenance of periplasmic redox homeostasis: DsbD transfers reducing equivalents from the cytoplasm to the periplasm, supporting the activity of various redox proteins essential for virulence.

  • Support of proper protein folding: By facilitating disulfide bond formation in secreted virulence factors and outer membrane proteins, DsbD ensures these proteins maintain their functional conformation.

  • Contribution to stress resistance: DsbD helps bacteria survive oxidative stress encountered during host infection, particularly within macrophages.

  • Connection to antimicrobial resistance: The protein folding pathway supported by DsbD affects the proper assembly of efflux pumps and other proteins involved in antibiotic resistance, which is an increasing concern with Shigella infections .

These functions make DsbD an attractive target for both vaccine development and potential antimicrobial strategies, particularly given the rise of antimicrobial-resistant Shigella strains .

What role might DsbD play in vaccine development against Shigella dysenteriae?

DsbD has several characteristics that make it relevant for Shigella vaccine development:

  • Conservation across serotypes: DsbD shows high sequence conservation, potentially providing cross-protection against multiple Shigella serotypes.

  • Essential function: As a protein critical for disulfide bond formation and virulence factor maturation, antibodies targeting DsbD could disrupt bacterial pathogenesis.

  • Surface accessibility: Portions of DsbD are potentially accessible to antibodies, making it a viable target for immune recognition.

  • Potential adjuvant properties: As a bacterial protein, DsbD may have inherent immunostimulatory properties that could enhance vaccine responses.

The development of a Shigella vaccine is considered an important public health goal, particularly given the rise of antimicrobial resistance and the significant disease burden worldwide . Similar to other Shigella vaccine candidates, a DsbD-based approach would likely require evaluation of serum bactericidal activity (SBA) as a functional measure of antibody efficacy .

How can researchers evaluate the immunogenicity of recombinant DsbD?

Researchers can employ multiple approaches to evaluate DsbD immunogenicity:

Assessment MethodApplicationKey Metrics
ELISAQuantification of antibody titersEndpoint titers, antibody isotypes
Serum Bactericidal Assay (SBA)Functional antibody activityIC50 values, bacterial killing efficiency
Flow CytometrySurface binding assessmentMean fluorescence intensity
Western BlotEpitope recognitionBand intensity, specificity
T-cell ProliferationCellular immunity assessmentStimulation index, cytokine profiles
Animal Challenge ModelsProtection evaluationSurvival rates, bacterial colonization

The high-throughput luminescence-based SBA assay has proven valuable for evaluating antibody functionality against Shigella. This method requires small serum volumes and provides consistent results, making it suitable for large-scale evaluation of vaccine-induced immunity . A strong correlation between SBA titers and anti-Shigella LPS serum IgG antibody concentrations has been demonstrated, suggesting that SBA can effectively complement ELISA data by indicating antibody functionality .

How does DsbD interact with other components of the bacterial disulfide bond formation pathway?

DsbD functions within a complex network of thiol-disulfide exchange reactions in the bacterial cell:

  • Electron flow pathway: DsbD receives electrons from cytoplasmic thioredoxin and transfers them to periplasmic thioredoxin-like proteins (DsbC, DsbG).

  • Domain organization: DsbD contains three domains - an N-terminal periplasmic domain, a central transmembrane domain, and a C-terminal periplasmic domain - that work in concert to transfer electrons across the membrane.

  • Substrate specificity: DsbD primarily interacts with oxidoreductases involved in disulfide isomerization and reduction, distinguishing it from the DsbA/DsbB pathway that catalyzes disulfide formation.

  • Regulatory interactions: The activity of DsbD is influenced by environmental conditions and stress responses, suggesting regulation at multiple levels.

Understanding these interactions is particularly important because disruption of proper protein folding pathways could render Shigella more susceptible to environmental stresses and host defense mechanisms.

What methodologies are effective for studying DsbD structure-function relationships?

Several complementary approaches can elucidate DsbD structure-function relationships:

  • Site-directed mutagenesis: Targeting conserved cysteine residues and other catalytically important amino acids to assess their contribution to activity.

  • Domain swapping: Creating chimeric proteins with domains from other DsbD homologs to identify specificity determinants.

  • Crystallography and structural biology:

    • X-ray crystallography of purified DsbD domains

    • Cryo-electron microscopy for membrane-embedded regions

    • NMR for dynamic regions and substrate interactions

  • Molecular dynamics simulations: Computational modeling of electron transfer pathways and conformational changes.

  • In vivo complementation studies: Expressing DsbD variants in knockout strains to assess functionality.

  • FRET-based interaction studies: Examining real-time interactions with partner proteins.

These approaches should be combined with functional assays measuring thiol:disulfide interchange activity to correlate structural features with catalytic properties.

What are common challenges in working with recombinant DsbD and how can they be addressed?

Researchers working with DsbD frequently encounter several challenges:

ChallengeCauseSolution
Protein misfoldingImproper disulfide formationExpression in specialized E. coli strains (e.g., Origami); addition of glutathione redox buffer
Low solubilityHydrophobic transmembrane regionsUse of detergents or membrane-mimetic systems; expression of soluble domains separately
Aggregation during storageFreeze-thaw damageAddition of 6% trehalose as cryoprotectant; maintenance of proper pH (8.0)
Activity lossOxidation of catalytic cysteinesAddition of reducing agents; handling under anaerobic conditions
Contaminating proteasesCo-purificationAdditional purification steps; inclusion of protease inhibitors
Variable yieldExpression conditionsOptimization of induction parameters (temperature, IPTG concentration)

Careful attention to buffer composition and storage conditions can significantly improve experimental outcomes. The recommended storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain protein stability .

How can researchers validate the proper folding and functionality of recombinant DsbD?

Validation of properly folded, functional DsbD should include multiple complementary assays:

  • Circular dichroism spectroscopy: To confirm secondary structure content.

  • Thermal shift assays: To assess protein stability and folding.

  • Size exclusion chromatography: To verify monomeric state and absence of aggregation.

  • Activity assays: Measuring thiol:disulfide interchange activity using model substrates.

  • Redox state analysis: Using alkylation agents to trap and analyze the oxidation state of catalytic cysteines.

  • Functional complementation: Testing whether the recombinant protein can restore function in DsbD-deficient bacterial strains.

  • Binding studies: Examining interactions with known DsbD protein partners.

The purity of the recombinant protein should be greater than 90% as determined by SDS-PAGE to ensure reliable results in these validation assays .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.