Recombinant Shigella dysenteriae serotype 1 UPF0059 membrane protein yebN (yebN)

What is the molecular structure and basic characteristics of Shigella dysenteriae serotype 1 UPF0059 membrane protein yebN?

Shigella dysenteriae serotype 1 UPF0059 membrane protein yebN is a full-length protein consisting of 188 amino acids with a specific amino acid sequence starting with MNITATVLLAFGMS and ending with GLVLIGIGVQILWTHFHG . As a membrane protein, yebN contains transmembrane domains that integrate into the bacterial cell membrane. The protein belongs to the UPF0059 family of membrane proteins, which are conserved across various enterobacterial species including E. coli .

The protein exhibits hydrophobic regions consistent with its membrane-spanning function, likely containing multiple transmembrane helices as suggested by its sequence pattern. The amino acid composition indicates a protein with predominantly hydrophobic residues interspersed with charged amino acids that facilitate proper membrane topology and function. The structural analysis suggests yebN adopts a conformation typical of integral membrane proteins with defined extracellular, transmembrane, and cytoplasmic domains.

How is recombinant Shigella dysenteriae yebN protein typically produced and purified for research applications?

Recombinant Shigella dysenteriae yebN protein is typically produced using heterologous expression systems, most commonly E. coli, though yeast, baculovirus, or mammalian cell expression systems can also be employed depending on experimental requirements . For bacterial expression, the yebN gene sequence is cloned into appropriate expression vectors, often incorporating affinity tags such as His-tags to facilitate purification .

The expression protocol typically involves:

• Transformation of the expression construct into competent E. coli cells

• Induction of protein expression using IPTG or other inducers

• Cell harvesting and lysis under conditions that preserve membrane protein structure

• Solubilization of membrane fractions using appropriate detergents

• Affinity chromatography purification using the incorporated tag

• Further purification steps such as ion exchange or size exclusion chromatography

For optimal stability, the purified protein is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Working aliquots should be maintained at 4°C for up to one week, and repeated freeze-thaw cycles should be avoided to prevent protein degradation and loss of activity .

What are the recommended storage and handling conditions for maintaining the stability of recombinant yebN protein?

For optimal stability and activity retention, recombinant yebN protein should be stored in a Tris-based buffer supplemented with 50% glycerol, which serves as a cryoprotectant . The standard storage temperature is -20°C, with extended storage recommended at -80°C to minimize degradation .

Specific handling recommendations include:

• Dividing the stock solution into single-use aliquots immediately after purification to minimize freeze-thaw cycles

• Storing working aliquots at 4°C for no longer than one week

• Avoiding repeated freezing and thawing of the same aliquot, as this significantly compromises protein integrity and activity

• Thawing frozen aliquots slowly on ice to prevent thermal shock

• Centrifuging the thawed protein briefly before use to remove any potential aggregates

These conditions are optimized specifically for maintaining the native conformation and functional properties of the membrane protein yebN, which requires special consideration due to its hydrophobic nature and tendency to aggregate when removed from appropriate buffer conditions .

What ELISA protocols are most effective for detecting and quantifying recombinant Shigella dysenteriae yebN protein?

For effective ELISA-based detection and quantification of recombinant Shigella dysenteriae yebN protein, researchers should consider both direct and sandwich ELISA approaches, with the latter typically offering higher sensitivity and specificity.

A recommended sandwich ELISA protocol includes:

• Plate Preparation: Coat high-binding 96-well plates with capture antibodies against yebN (1-5 μg/ml in carbonate buffer, pH 9.6) overnight at 4°C.

• Blocking: Block remaining binding sites with 2-5% BSA or milk protein in PBS-T for 1-2 hours at room temperature.

• Sample Addition: Apply serially diluted yebN protein standards and unknown samples, incubate for 2 hours at room temperature or overnight at 4°C.

• Detection: Add biotinylated detection antibody specific to another epitope of yebN (0.5-2 μg/ml), followed by streptavidin-HRP conjugate.

• Development: Develop with TMB substrate and stop with 2N H₂SO₄, then read absorbance at 450 nm.

For membrane proteins like yebN, modification of standard protocols may be necessary:

• Include 0.01-0.05% detergent (such as DDM or CHAPS) in buffers to maintain protein solubility

• Optimize detergent concentration to prevent interference with antibody binding

• Consider direct coating of membrane protein preparations in methanol-containing buffers for improved binding to the plate surface

When analyzing results, researchers should establish standard curves using purified recombinant yebN protein of known concentration, employing four-parameter logistic regression for accurate quantification .

How can researchers effectively compare the structural and functional characteristics of Shigella dysenteriae yebN with homologous proteins from E. coli?

Researchers can employ multiple comparative approaches to analyze the structural and functional characteristics of Shigella dysenteriae yebN relative to its E. coli homologs. These approaches should be integrated to form a comprehensive comparative analysis:

• Sequence Alignment Analysis:

  • Perform multiple sequence alignments using tools like Clustal Omega or MUSCLE

  • Calculate sequence identity and similarity percentages

  • Identify conserved domains, motifs, and critical residues

  • The amino acid sequences from Shigella dysenteriae yebN and E. coli yebN show high conservation, particularly in membrane-spanning domains

• Structural Comparison:

  • Generate predicted 3D structures using homology modeling (SWISS-MODEL, Phyre2)

  • Compare transmembrane topology predictions (TMHMM, TOPCONS)

  • Analyze conservation of key structural elements

  • Visualize structural differences using PyMOL or similar software

• Functional Characterization:

  • Complement studies: Express each protein in yebN-knockout strains of the reciprocal organism

  • Assess membrane localization patterns using GFP fusion proteins

  • Measure ion transport capabilities under standardized conditions

  • Compare protein-protein interactions using pull-down assays or yeast two-hybrid screens

• Evolutionary Analysis:

  • Construct phylogenetic trees to understand evolutionary relationships

  • Calculate selection pressures on different protein domains (dN/dS ratios)

  • Identify lineage-specific adaptations

From the available sequence data, both proteins share identical or nearly identical amino acid sequences (MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG), suggesting conservation of function across these enterobacterial species .

What are the most effective expression systems and conditions for producing functional recombinant Shigella dysenteriae yebN protein?

The selection of expression systems for producing functional recombinant Shigella dysenteriae yebN protein should be guided by the intended downstream applications and the requirement for proper folding of this membrane protein. Based on current research methodologies, the following expression systems and conditions are recommended:

• E. coli-based Expression:

  • Strain Selection: BL21(DE3), C41(DE3), or C43(DE3) strains specifically engineered for membrane protein expression

  • Vector Design: pET or pBAD vectors with regulatable promoters and appropriate fusion tags (His6, MBP, or SUMO)

  • Induction Conditions: Low IPTG concentration (0.1-0.5 mM) at reduced temperature (16-25°C)

  • Media Composition: Enriched media (2XYT or TB) supplemented with glucose for leaky promoter control

  • Expression Duration: Extended expression periods (16-24 hours) at lower temperatures to facilitate proper membrane insertion

• Yeast Expression Systems:

  • Pichia pastoris or Saccharomyces cerevisiae systems offer eukaryotic processing capabilities

  • Methanol-inducible promoters for Pichia or galactose-inducible promoters for S. cerevisiae

  • Growth in minimal media with selective pressure to maintain expression constructs

• Mammalian Cell Expression:

  • HEK293 or CHO cells for applications requiring mammalian glycosylation patterns

  • Transient transfection followed by selection of stable cell lines

  • Serum-free media formulations to simplify downstream purification

For membrane protein yebN, the following specific considerations should be implemented:

• Addition of membrane-stabilizing agents (glycerol 10-15%)

• Precise temperature control during induction phase (typically 18°C)

• Harvesting cells at optimal OD600 (typically 0.6-0.8 before induction)

• Gentle lysis procedures using specialized detergents (DDM, LDAO) for membrane protein extraction

The E. coli system remains the most commonly used due to its high yield and simplicity, with multiple studies demonstrating successful expression of yebN and related membrane proteins using this approach . The expressed protein is typically purified using affinity chromatography facilitated by an N-terminal or C-terminal His-tag, followed by size exclusion chromatography to ensure homogeneity .

What is currently known about the biological function of UPF0059 membrane protein yebN in Shigella dysenteriae and related bacteria?

The UPF0059 membrane protein yebN in Shigella dysenteriae and related enterobacteria remains partially characterized, with evolving understanding of its biological functions. Current research suggests multiple potential roles:

• Membrane Transport Functions:

  • Evidence indicates yebN may function as a divalent cation transporter, particularly for magnesium (Mg²⁺) ions

  • Structural analysis suggests transmembrane channels with charged residues that could facilitate ion movement across membranes

  • Knockdown studies in related bacteria show altered sensitivity to metal ion concentrations

• Stress Response Involvement:

  • Expression patterns indicate upregulation during specific environmental stresses

  • May contribute to bacterial adaptation to host environments during infection

  • Potentially involved in acid tolerance response systems

• Cell Envelope Integrity:

  • Contributes to maintaining bacterial membrane composition and function

  • May participate in protein-protein interactions within the membrane that stabilize complex membrane structures

  • Deletion mutants often show altered membrane permeability characteristics

• Pathogenesis Connections:

  • The conservation of yebN across pathogenic Enterobacteriaceae suggests a possible role in virulence

  • May function in conjunction with other virulence factors during host infection

  • Could contribute to bacterial survival within host cells during the Shigella infection cycle

How does yebN protein contribute to Shigella dysenteriae pathogenesis and virulence mechanisms?

While direct evidence specifically linking yebN to Shigella dysenteriae pathogenesis remains incomplete, integrated analysis of membrane protein function and Shigella virulence mechanisms suggests several potential contributions:

• Environmental Adaptation within the Host:

  • YebN likely contributes to bacterial adaptation to changing ionic conditions encountered during host invasion

  • May participate in maintaining membrane integrity under stress conditions within the host cell environment

  • Could function in bacterial responses to antimicrobial peptides encountered during infection

• Potential Interactions with Virulence Systems:

  • As a membrane protein, yebN may physically or functionally interact with known Shigella virulence factors

  • Could contribute to the regulation or assembly of membrane-associated secretion systems

  • May participate in signaling pathways that coordinate virulence gene expression

• Contributions to Intracellular Survival:

  • Shigella's lifecycle includes intracellular phases where membrane protein function is critical

  • YebN may help maintain membrane potential or ion homeostasis during intracellular stages

  • Could participate in defense against host cell antimicrobial mechanisms

• Comparative Evidence from Related Pathogens:

  • Studies of homologous proteins in related enterobacteria suggest potential roles in stress response

  • Conservation across pathogenic species indicates functional importance in bacterial-host interactions

  • Research on E. coli homologs provides insight into potential pathogenesis-related functions

The high sequence conservation of yebN across Shigella dysenteriae and various E. coli strains suggests fundamental importance to cellular physiology . Recent advances in recombinant Shigella systems for vaccine development highlight the importance of membrane components in pathogenesis and immune response, though yebN itself has not been specifically targeted in these approaches . Further research employing knockout studies, protein-protein interaction analyses, and in vivo infection models will be necessary to fully characterize yebN's role in Shigella pathogenesis.

What protein-protein interactions and molecular pathways involve the yebN protein in bacterial cellular processes?

The protein-protein interactions and molecular pathways involving yebN remain an active area of investigation. Based on structural predictions, conservation patterns, and studies of homologous systems, the following interactions and pathways are likely relevant:

• Membrane Protein Complexes:

  • YebN likely participates in homo-oligomeric or hetero-oligomeric membrane complexes

  • Potential interactions with other membrane transporters in functional complexes

  • May associate with membrane scaffolding proteins that organize transport systems

  • Could interact with peptidoglycan synthesis machinery at the membrane-cell wall interface

• Signaling Pathways:

  • Possible involvement in two-component signaling systems that sense environmental conditions

  • May interact with cytoplasmic regulators that control gene expression in response to membrane status

  • Could participate in stress response pathways activated during host infection

  • Potential interactions with small regulatory RNAs or their protein partners

• Transport Mechanisms:

  • Likely functions in ion homeostasis pathways, particularly involving magnesium or other divalent cations

  • May participate in proton-coupled transport mechanisms

  • Could contribute to maintenance of membrane potential

  • Possible involvement in metal detoxification pathways

• Methodologies for Investigating Interactions:

  • Bacterial two-hybrid systems adapted for membrane protein analysis

  • Co-immunoprecipitation with carefully optimized detergent conditions

  • Cross-linking followed by mass spectrometry (XL-MS)

  • Fluorescence resonance energy transfer (FRET) using fluorescently tagged protein pairs

  • Blue native PAGE for analyzing intact membrane protein complexes

The charged regions and conserved motifs in the yebN sequence (MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG) suggest specific interaction domains, particularly the conserved acidic region (FRGADDEDEEPRRR) that may mediate protein-protein interactions or ion coordination . Further experimental work combining structural biology, functional genomics, and interactomics approaches will be necessary to fully map the interaction network of this membrane protein.

How can researchers effectively utilize recombinant yebN protein in vaccine development against Shigella dysenteriae?

Utilizing recombinant yebN protein in vaccine development against Shigella dysenteriae requires strategic approaches that leverage current understanding of bacterial membrane proteins as vaccine components. While yebN has not been specifically employed in vaccine platforms to date, the following methodological framework can guide research efforts:

• Antigen Design Strategies:

  • Epitope Mapping: Identify immunodominant regions of yebN through computational prediction and experimental validation

  • Construct Optimization: Design constructs containing key extracellular loops while removing hydrophobic transmembrane regions

  • Fusion Protein Approaches: Create chimeric proteins combining yebN epitopes with known immunogenic carriers

  • Multiepitope Vaccines: Integrate yebN epitopes with other Shigella antigens for broader protection

• Recombinant Protein Production for Vaccine Applications:

  • Expression systems must be optimized for high yield and proper folding

  • Purification protocols should achieve >95% purity with minimal endotoxin contamination

  • Stability studies under various formulation conditions are essential

  • Batch-to-batch consistency validation through analytical characterization

• Delivery Systems and Adjuvant Selection:

  • Outer Membrane Vesicles (OMVs): Incorporate yebN into OMVs, similar to approaches with other Shigella antigens

  • Liposomal Formulations: Embed purified yebN in liposomes to maintain native conformation

  • Adjuvant Compatibility: Test compatibility with aluminum salts, oil-in-water emulsions, and TLR agonists

  • Mucosal Delivery Systems: Develop formulations suitable for oral or intranasal administration

• Immunological Evaluation Framework:

  • In Vitro Assays: Measure antibody binding, functional activity, and cellular responses

  • Animal Models: Assess immunogenicity and protection in appropriate small animal models

  • Immune Correlates: Define correlates of protection focusing on mucosal and systemic responses

  • Cross-Protection Analysis: Evaluate activity against diverse Shigella strains and serotypes

Recent research on recombinant Shigella vaccine development has demonstrated the potential of incorporating bacterial membrane components into vaccine platforms, particularly using outer membrane vesicles as delivery vehicles . While these approaches have not specifically targeted yebN, they establish proof-of-concept for similar strategies. The successful expression of recombinant yebN with appropriate tags provides the necessary foundation for incorporating this protein into novel vaccine constructs .

What are the most effective methods for studying the three-dimensional structure of membrane protein yebN and its structural dynamics?

Determining the three-dimensional structure of membrane proteins like yebN presents unique challenges due to their hydrophobic nature and requirement for a lipid environment. A comprehensive approach combining multiple complementary techniques offers the best strategy:

• X-ray Crystallography Approaches:

  • Lipidic Cubic Phase (LCP) Crystallization: Maintains membrane protein in native-like environment

  • Detergent Screening: Systematic testing of detergents for optimal crystal formation

  • Fusion Protein Strategies: Addition of crystallization chaperones (e.g., T4 lysozyme) to stabilize structure

  • Nanobody Co-crystallization: Using nanobodies to lock specific conformations

  • Microcrystal Techniques: Serial femtosecond crystallography at X-ray free electron lasers (XFELs)

• Cryo-Electron Microscopy Methods:

  • Single Particle Analysis: For larger yebN complexes or oligomeric assemblies

  • 2D Crystallization: Forming 2D crystals in lipid bilayers for electron crystallography

  • Subtomogram Averaging: For structural determination in cellular contexts

  • Sample Preparation Optimization: Vitrification conditions, grid types, and detergent concentration

• NMR Spectroscopy Approaches:

  • Solution NMR: Using specialized detergent micelles for smaller membrane proteins

  • Solid-State NMR: Studying yebN reconstituted into lipid bilayers or nanodiscs

  • Selective Isotope Labeling: Strategic 15N, 13C, or 19F labeling of specific residues

  • Dynamics Measurements: Relaxation experiments to probe conformational changes

• Computational and Hybrid Methods:

  • Molecular Dynamics Simulations: Exploring conformational dynamics in simulated membranes

  • Homology Modeling: Leveraging structures of related proteins

  • Integrative Modeling: Combining low-resolution experimental data with computational approaches

  • Evolutionary Coupling Analysis: Identifying co-evolving residues to infer structural contacts

• Biophysical Characterization of Dynamics:

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Probing conformational accessibility

  • FRET-based Approaches: Measuring distances between labeled sites during conformational changes

  • EPR Spectroscopy: Spin labeling to monitor local environments and distances

  • Time-resolved Studies: Capturing transient conformational states

For yebN specifically, a strategic approach might begin with homology modeling based on similar UPF0059 family proteins, followed by experimental validation. The protein's relatively small size (188 amino acids) makes it potentially amenable to solution NMR approaches after optimization of detergent conditions . Complementary techniques should be employed to generate a comprehensive understanding of both structure and dynamics relevant to function.

How can CRISPR-Cas9 technology be applied to study the function of yebN gene in Shigella dysenteriae pathogenesis?

CRISPR-Cas9 technology offers powerful approaches for investigating yebN function in Shigella dysenteriae through precise genetic manipulation. The following methodological framework details strategies for applying this technology:

• Gene Knockout and Functional Analysis:

  • sgRNA Design: Create guide RNAs targeting conserved regions of the yebN gene using algorithms that maximize on-target efficacy and minimize off-target effects

  • Delivery Systems: Optimize plasmid-based or ribonucleoprotein (RNP) delivery methods for Shigella

  • Screening Protocol:

    • PCR-based genotyping of putative mutants

    • Sanger sequencing to confirm indel formation

    • Western blotting to verify protein absence

  • Phenotypic Characterization:

    • Growth curves under various conditions (pH, ion concentrations, stress factors)

    • Membrane integrity assays

    • Virulence assessment in cellular and animal models

• Gene Editing for Site-Directed Mutagenesis:

  • HDR Template Design: Create repair templates with specific mutations in conserved domains

  • Base Editing Approach: Apply cytosine or adenine base editors for precise point mutations

  • Prime Editing: Utilize prime editing for scarless introduction of specific mutations

  • Target Residues: Focus on charged residues in transmembrane regions and conserved motifs identified through sequence analysis

• CRISPRi/CRISPRa for Gene Expression Modulation:

  • dCas9-based Repression: Deploy catalytically dead Cas9 fused to repressor domains

  • Inducible Systems: Create arabinose or tetracycline-inducible CRISPRi systems

  • Dosage-Response Analysis: Evaluate effects of partial yebN repression

  • Temporal Regulation: Study effects of yebN depletion at different infection stages

• CRISPR Screening for Interaction Partners:

  • Pooled Library Approach: Generate genome-wide sgRNA libraries in yebN-tagged strains

  • Selection Strategy: Apply conditions where yebN function is critical

  • Synthetic Lethality Screens: Identify genes that become essential when yebN is compromised

  • Next-generation Sequencing Analysis: Quantify sgRNA enrichment/depletion

• In Vivo Applications:

  • Animal Infection Models: Compare wild-type and yebN mutant strains in appropriate models

  • Tissue-specific Analyses: Track bacterial distribution and behavior in different host tissues

  • Competition Assays: Co-infect with tagged wild-type and mutant strains to assess fitness

The integration of CRISPR technologies with other approaches, such as RNA-seq for transcriptional profiling and proteomics for interaction mapping, would provide comprehensive insights into yebN function. Recent advances in recombinant Shigella systems for vaccine development demonstrate the feasibility of genetic manipulation in these bacteria , providing methodological foundations for applying CRISPR technologies to study yebN function in pathogenesis.

How conserved is the yebN protein sequence across different Shigella species and other Enterobacteriaceae, and what does this suggest about its evolutionary importance?

The conservation pattern of yebN across Shigella species and other Enterobacteriaceae provides significant insights into its evolutionary importance and functional constraints. A comprehensive analysis reveals:

• Sequence Conservation Analysis:

  • High Conservation Level: The yebN protein sequence shows remarkable conservation, with near-identical sequences between Shigella dysenteriae serotype 1 and various E. coli strains

  • Identical Core Regions: The 188-amino acid sequence (MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG) is perfectly preserved across multiple enterobacterial species

  • Transmembrane Domains: Particularly high conservation in transmembrane regions, suggesting strict structural constraints

  • Charged Residue Patterns: Conserved distribution of charged residues critical for function

• Evolutionary Rate Analysis:

  • Purifying Selection: Evidence of strong purifying selection (low dN/dS ratio) indicates functional importance

  • Domain-specific Rates: Potentially different evolutionary rates across protein domains

  • Coevolutionary Patterns: Likely coevolution with interacting partners

• Phylogenetic Distribution:

  • Universal Presence: Found across all analyzed Shigella and E. coli strains

  • Broader Enterobacteriaceae: Present in related genera including Salmonella and Klebsiella

  • Consistent Genomic Context: Often maintained in similar genomic neighborhoods

  • Horizontal Transfer Potential: Low evidence for horizontal gene transfer, suggesting vertical inheritance

• Functional Implications:

  • Essential Function: High conservation suggests yebN likely performs a fundamental cellular function

  • Physiological Constraints: Similar selective pressures across diverse bacterial lifestyles

  • Limited Functional Divergence: Minimal evidence for functional specialization despite pathogenic diversity

  • Ancient Origin: Likely present in the common ancestor of Enterobacteriaceae

The identical or nearly identical amino acid sequences observed between Shigella dysenteriae and E. coli variants of yebN (including strains O6 and O1:K1/APEC) strongly suggests that this protein performs a core physiological function conserved across these related bacterial species . This level of conservation is consistent with proteins involved in fundamental cellular processes such as membrane integrity, ion homeostasis, or essential transport functions. The conservation pattern contrasts with the diversity seen in pathogenicity-specific factors, suggesting yebN likely serves a basic cellular function rather than a specific virulence role, though it may indirectly contribute to pathogenesis through its core physiological function.

What experimental approaches can researchers use to investigate potential differences in function between yebN proteins from different bacterial species?

To investigate functional differences between yebN proteins from different bacterial species, researchers should employ a multi-faceted experimental approach that combines complementation studies, biochemical characterization, and advanced molecular techniques:

• Genetic Complementation Studies:

  • Cross-species Complementation:

    • Generate yebN deletion mutants in multiple bacterial species

    • Create expression constructs with yebN variants from different species

    • Test ability of each variant to rescue phenotypes in different host backgrounds

    • Quantify complementation efficiency through growth rates, stress resistance, and other phenotypic assays

  • Chimeric Protein Analysis:

    • Design domain-swapped variants between species

    • Identify which regions confer species-specific functionality

    • Create systematic chimera libraries for high-resolution mapping

• Biochemical Characterization:

  • Transport Assays:

    • Reconstitute purified yebN variants into liposomes

    • Measure ion flux using fluorescent indicators or radioactive tracers

    • Compare kinetic parameters (Km, Vmax) across species variants

    • Test substrate specificity under identical conditions

  • Structural Studies:

    • Perform comparative structural analysis using identical methods

    • Identify species-specific conformational differences

    • Map potential functional sites through mutagenesis

    • Study detergent solubility profiles as a proxy for membrane interactions

• Protein-Protein Interaction Mapping:

  • Interactome Analysis:

    • Perform pull-down assays with tagged yebN variants

    • Use mass spectrometry to identify species-specific interaction partners

    • Validate key interactions through co-immunoprecipitation

    • Quantify binding affinities for conserved partners

  • Bacterial Two-Hybrid Screens:

    • Generate species-specific interaction libraries

    • Compare interaction profiles across bacterial species

    • Focus on differences in membrane protein complexes

• Environmental Response Profiling:

  • Stress Response Analysis:

    • Test yebN variants under identical stress conditions

    • Measure growth, survival, and physiological parameters

    • Identify species-specific differences in functional contribution

    • Use reporter fusions to monitor expression under varied conditions

  • Host Cell Interaction Studies:

    • Compare infection dynamics with isogenic strains expressing different yebN variants

    • Assess intracellular survival, replication, and host cell responses

    • Measure membrane potential and ion homeostasis during infection

• Systems Biology Approaches:

  • Transcriptome Analysis:

    • Compare gene expression profiles in strains with different yebN variants

    • Identify species-specific regulatory networks

    • Perform RNA-seq under multiple environmental conditions

  • Metabolomic Studies:

    • Measure global metabolite profiles

    • Identify metabolic pathways differentially affected by yebN variants

    • Focus on membrane-related metabolites and signaling molecules

The nearly identical amino acid sequences observed between Shigella dysenteriae and E. coli yebN proteins suggest structural conservation, but even subtle sequence differences might confer species-specific functional adaptations . These experimental approaches would systematically identify and characterize such differences, providing insights into the evolutionary adaptation of this membrane protein across different bacterial lifestyles and pathogenic niches.

What are the most promising future research directions for understanding the role of yebN in bacterial physiology and pathogenesis?

Future research on yebN in bacterial physiology and pathogenesis should focus on several promising directions that leverage emerging technologies and integrate multiple disciplines:

• Structural Biology and Dynamics:

  • High-Resolution Structure Determination: Apply cryo-EM or X-ray crystallography to resolve atomic-level structures

  • Conformational Dynamics: Investigate structural changes during transport cycles using spectroscopic methods

  • In silico Molecular Dynamics: Simulate yebN behavior in realistic membrane environments

  • Structure-Guided Drug Design: Develop potential inhibitors based on structural insights

• Systems-Level Integration:

  • Global Interaction Networks: Map the complete protein-protein interaction landscape of yebN

  • Multi-omics Integration: Combine transcriptomics, proteomics, and metabolomics in yebN mutants

  • Regulatory Circuit Mapping: Identify control mechanisms governing yebN expression and activity

  • Host-Pathogen Interface: Characterize yebN's role in host-bacterial interactions during infection

• Translational Applications:

  • Antimicrobial Target Assessment: Evaluate yebN as a potential drug target based on conservation and essentiality

  • Vaccine Development: Investigate the immunogenic potential of yebN-derived epitopes

  • Diagnostic Applications: Develop detection methods for bacterial identification based on yebN conservation

  • Engineered Probiotics: Create modified bacteria with optimized yebN function for therapeutic applications

• Advanced Genetic Approaches:

  • Genome-Wide Interaction Screens: Identify synthetic lethal and synthetic rescue relationships

  • In vivo Mutation Analysis: Apply deep mutational scanning to comprehensively map functional residues

  • Single-Cell Studies: Investigate cell-to-cell variability in yebN function and expression

  • Conditional Degradation Systems: Develop tools for temporal control of yebN levels

• Evolutionary and Comparative Studies:

  • Broader Phylogenetic Analysis: Extend studies to more distant bacterial relatives

  • Host Adaptation Signatures: Identify evolutionary patterns related to host specialization

  • Environmental Isolate Characterization: Compare yebN function across environmental and clinical isolates

  • Experimental Evolution: Track yebN adaptations under selective pressures

The remarkable conservation of yebN sequence across diverse bacterial species, including Shigella dysenteriae and various E. coli strains, suggests fundamental importance to bacterial physiology . Recent advances in recombinant protein production and bacterial genetic manipulation provide the technical foundation for these future research directions. Combined with emerging structural biology methods and systems approaches, these strategies will illuminate the multifaceted roles of yebN in bacterial physiology and potentially identify new therapeutic opportunities.

How might understanding yebN function contribute to developing novel antimicrobial strategies against Shigella and related pathogens?

Understanding yebN function could significantly contribute to novel antimicrobial strategies against Shigella and related pathogens through multiple therapeutic avenues:

• Direct Inhibitor Development:

  • Structure-Based Drug Design: Utilize structural information to design small molecule inhibitors targeting critical functional regions

  • Allosteric Modulators: Develop compounds that interfere with conformational changes required for function

  • Peptide-Based Inhibitors: Design peptides that mimic interaction partners to disrupt protein-protein interactions

  • Phage-Derived Inhibitors: Identify phage proteins that naturally target yebN during infection

• Membrane Integrity Disruption:

  • Combination Therapies: Target yebN in conjunction with other membrane-disrupting agents

  • Permeabilization Enhancement: Use yebN inhibition to increase susceptibility to existing antibiotics

  • Ion Homeostasis Disruption: Exploit yebN's potential role in ion transport to destabilize bacterial physiology

  • Stress Response Amplification: Combine with environmental stressors that require yebN function for resistance

• Vaccine Development Approaches:

  • Epitope Identification: Map immunogenic regions of yebN for subunit vaccine development

  • Cross-Protection Strategies: Leverage conservation to develop broadly protective vaccine formulations

  • OMV-Based Platforms: Incorporate yebN into outer membrane vesicle vaccine platforms

  • Chimeric Antigen Design: Create fusion proteins combining yebN epitopes with established immunogens

• Diagnostic Applications:

  • Rapid Detection Methods: Develop molecular or antibody-based tests targeting yebN

  • Species Differentiation: Use minor sequence variations for precise bacterial identification

  • Antimicrobial Resistance Monitoring: Correlate yebN mutations with resistance phenotypes

  • Point-of-Care Testing: Create field-deployable diagnostics for resource-limited settings

• Bacteriophage-Based Approaches:

  • Engineered Phage Therapy: Develop phages specifically targeting bacteria through yebN recognition

  • CRISPR Delivery Systems: Use phages to deliver CRISPR-Cas systems targeting yebN

  • Synthetic Biology Platforms: Create genetic circuits that respond to yebN inhibition

The high conservation of yebN across pathogenic species provides an attractive target for broad-spectrum approaches . Research on recombinant Shigella systems has already demonstrated the potential for targeting conserved bacterial components in vaccine development , suggesting similar approaches could be applied to yebN. Additionally, the membrane localization of yebN makes it potentially accessible to drugs without requiring cellular penetration, an advantage for antibiotic development.