Recombinant Shigella dysenteriae serotype 1 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; SDY_3070; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISKNKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links

KEGG: sdy:SDY_3070

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0114 protein YqhA and what is its structural characterization?

UPF0114 protein YqhA is a transmembrane protein located in the plasma membrane. It contains a characteristic domain from amino acid positions 9 to 125 that belongs to the uncharacterized protein family UPF0114. Additionally, it features a helical transmembrane region spanning from position 15 to 35 . While the complete three-dimensional structure remains incompletely characterized, homology modeling attempts have shown limited success, with only 48% confidence when compared to the Mrp antiporter complex . Researchers typically employ a combination of X-ray crystallography, NMR spectroscopy, and cryo-electron microscopy to elucidate the structural details of membrane proteins like YqhA, though these approaches present technical challenges due to the protein's hydrophobic nature.

How does YqhA differ between Shigella dysenteriae and other Shigella species?

While Shigella dysenteriae type 1 is known to cause particularly severe disease compared to other Shigella species , the specific differences in YqhA structure and function across Shigella species remain incompletely characterized in the current literature. Comparative genomic and proteomic analyses would be necessary to fully elucidate species-specific variations. When investigating these differences, researchers should employ sequence alignment tools to compare protein homology, followed by functional assays to determine if any structural differences correlate with altered protein function or virulence contribution.

What is the putative function of YqhA in Shigella?

Based on homology studies in other bacteria, YqhA likely plays a role in stress response modulation. In Bacillus subtilis, YqhA has been identified as a paralog to rsbR, which encodes a positive regulator of sigma factor σB and functions in environmental stress response signaling . This suggests that in Shigella species, YqhA may have a similar role in stress modulation, potentially contributing to bacterial survival under adverse conditions. Further functional characterization through knockout studies, complementation assays, and stress response experiments would help confirm this putative function in Shigella dysenteriae specifically.

How do mutations in YqhA affect bacterial phenotype?

Mutations in YqhA can significantly alter bacterial phenotypes, particularly related to stress tolerance. For example, a missense mutation (W14L) in YqhA of evolved E. coli strains has been associated with enhanced tolerance to inhibitory compounds . This tryptophan to leucine substitution at position 14, adjacent to the transmembrane region, potentially alters the protein's ability to recognize or transport hydrophobic ligands such as phenols and furfural . To characterize mutation effects, researchers should employ site-directed mutagenesis followed by phenotypic assays under various stress conditions.

What methodologies are most effective for analyzing YqhA interactions with membrane components?

For analyzing YqhA interactions with membrane components, researchers should implement a multi-faceted approach combining:

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify direct protein-protein interactions

  • Fluorescence resonance energy transfer (FRET): For monitoring real-time protein interactions in living cells

  • Co-immunoprecipitation: To pull down protein complexes containing YqhA and its interaction partners

  • Bacterial two-hybrid systems: Particularly useful for membrane protein interactions

  • Lipidomic analysis: To determine specific lipid interactions, which may be especially relevant since the W14L mutation in YqhA affects a region potentially involved in binding hydrophobic ligands

These approaches should be complemented with computational modeling to predict interaction sites, followed by targeted mutagenesis to confirm their functional significance.

How does YqhA contribute to inhibitor tolerance mechanisms in Shigella dysenteriae?

Based on findings in evolved E. coli strains, YqhA appears to contribute significantly to inhibitor tolerance mechanisms. The W14L mutation in YqhA has been identified in inhibitor-tolerant E. coli strains, suggesting this protein plays a role in chemical stress response . In these strains, YqhA may function together with other stress response systems, including the YqhD-DkgA oxidoreductive system known to detoxify aldehydes and other inhibitory compounds .

To experimentally determine YqhA's role in inhibitor tolerance in Shigella dysenteriae specifically, researchers should:

  • Generate YqhA knockout strains

  • Create strains with specific YqhA mutations (e.g., W14L)

  • Perform comprehensive inhibitor challenge assays

  • Measure gene expression changes under inhibitor stress

  • Conduct metabolomic analyses to track detoxification pathways

The resulting data should be analyzed for correlation between YqhA status and inhibitor tolerance phenotypes.

What is the relationship between YqhA and pathogenicity in Shigella dysenteriae serotype 1?

To investigate this relationship, researchers should employ:

  • Cell invasion assays: Using YqhA-knockout or mutant strains to assess effects on epithelial cell invasion

  • Animal infection models: To evaluate virulence in vivo

  • Transcriptomic analysis: To identify genes co-regulated with YqhA during infection

  • Host response studies: To determine if YqhA affects host immune recognition

  • Comparative analysis: With other Shigella species to correlate YqhA variations with virulence differences

These experiments would help establish whether YqhA contributes directly or indirectly to the enhanced pathogenicity of S. dysenteriae serotype 1.

How does the structure-function relationship of YqhA compare between evolved resistant strains and wild-type Shigella?

The comparison of YqhA structure-function relationships between resistant and wild-type strains offers valuable insights into adaptation mechanisms. In evolved E. coli strains, the W14L mutation in YqhA contributes to inhibitor tolerance . This mutation affects a tryptophan residue near the transmembrane region, potentially altering recognition of hydrophobic ligands .

To comprehensively investigate this relationship in Shigella, researchers should:

  • Structural analysis: Employ circular dichroism and other techniques to compare protein conformations

  • Functional assays: Measure membrane permeability, inhibitor binding, and stress response in isogenic strains differing only in YqhA variants

  • Site-directed mutagenesis: Create a panel of mutations to map critical functional residues

  • Heterologous expression: Express different YqhA variants in a common genetic background to isolate protein-specific effects

  • Computational modeling: Predict structural changes caused by mutations and their functional implications

This experimental approach allows for detailed mapping of structure-function relationships in wild-type versus resistant strains.

What experimental approaches are most effective for studying YqhA's role in bacterial stress response signaling?

Based on the homology between YqhA and stress response regulators in other bacteria , several experimental approaches are recommended for studying its role in signaling:

Experimental ApproachMethodologyExpected OutcomeLimitations
RNA-SeqCompare transcriptomes of wild-type vs. YqhA mutants under stressIdentification of YqhA-regulated gene networksMay not detect post-transcriptional effects
PhosphoproteomicsAnalyze phosphorylation changes in signaling proteinsMap YqhA-dependent signaling cascadesTechnical challenges with membrane proteins
Reporter AssaysUse stress-responsive promoters coupled to reportersDirect measurement of stress response activationLimited to known stress pathways
ChIP-SeqIdentify DNA binding sites of transcription factors affected by YqhAMap regulatory network connectionsRequires knowledge of downstream factors
Bacterial Two-HybridScreen for protein-protein interactionsIdentify direct interaction partnersMay yield false positives/negatives

The most robust approach combines these methods to build a comprehensive model of YqhA's role in stress response signaling, with particular attention to how these pathways may contribute to pathogenicity and inhibitor tolerance.

What purification strategies yield the highest activity of recombinant YqhA protein?

For optimal purification of active recombinant YqhA, researchers should consider:

  • Expression system selection: While E. coli and yeast systems offer high yields and faster turnaround times, insect cells or mammalian expression systems may be necessary when post-translational modifications are critical for activity

  • Membrane protein extraction: Use mild detergents (DDM, LMNG, or digitonin) that maintain the native conformation while solubilizing the protein from membranes

  • Affinity purification optimization: For his-tagged constructs, employ IMAC with controlled imidazole gradients to minimize non-specific binding while maximizing target protein recovery

  • Size exclusion chromatography: As a secondary purification step to ensure protein homogeneity and remove aggregates

  • Activity preservation: Maintain membrane protein stability through the addition of appropriate lipids during purification and storage

Each purification batch should be assessed for purity via SDS-PAGE and activity through functional assays specific to predicted YqhA functions.

How can researchers effectively design knockout and complementation studies for YqhA in Shigella dysenteriae?

For effective genetic manipulation studies of YqhA in Shigella dysenteriae, researchers should:

  • Knockout strategy selection:

    • Lambda Red recombination system for precise gene replacement

    • CRISPR-Cas9 for clean deletions without antibiotic markers

    • Construction of multiple knockout strains with different selectable markers for experimental flexibility

  • Complementation design:

    • Use low-copy plasmids with native promoters for physiological expression levels

    • Include inducible systems (tetR, araC) for controlled expression studies

    • Create multiple complementation constructs with varying tags (C-terminal, N-terminal) to account for potential functional interference

  • Verification approaches:

    • PCR confirmation of genetic modifications

    • RT-qPCR to verify transcript absence/presence

    • Western blotting to confirm protein expression

    • Whole genome sequencing to rule out off-target effects

  • Phenotypic characterization:

    • Growth curve analysis under various stress conditions

    • Inhibitor tolerance assays with multiple compound classes

    • Virulence-associated phenotypes including cell invasion assays

This systematic approach ensures rigorous evaluation of YqhA function through both loss and restoration of gene expression.

What are the challenges and solutions for structural studies of YqhA as a transmembrane protein?

Structural studies of YqhA face significant challenges due to its transmembrane nature. Researchers should consider these challenges and solutions:

ChallengeSolutionMethodological Details
Low expression yieldsOptimize codon usage and expression conditionsUse strain-specific codon optimization and test multiple induction parameters
Protein instabilityIncorporate stabilizing mutationsIdentify and test thermostabilizing mutations based on sequence analysis
Detergent selectionScreen multiple detergentsPerform systematic detergent screening (DDM, LMNG, GDN) and assess protein stability
Crystallization difficultiesExplore lipidic cubic phase methodsLCP crystallization specifically designed for membrane proteins
Conformational heterogeneityUse conformation-specific antibodies or nanobodiesGenerate or screen for binding partners that lock the protein in specific states
Data interpretationCombine multiple structural methodsIntegrate X-ray crystallography, cryo-EM, and NMR data for comprehensive structural model

Previous attempts at homology modeling of YqhA showed limited success (48% confidence with the Mrp antiporter complex template) , highlighting the need for experimental structural determination rather than relying solely on computational approaches.

What experimental designs best elucidate the potential role of YqhA in Shigella stress response?

To systematically investigate YqhA's role in stress response, researchers should implement a multi-tier experimental design:

  • Stress condition screening:

    • Challenge wild-type and YqhA-deficient Shigella with a panel of stressors (oxidative, acid, osmotic, bile salts, antimicrobial peptides)

    • Measure survival rates, growth kinetics, and morphological changes

    • Identify conditions with the most significant phenotypic differences

  • Transcriptomic profiling:

    • Perform RNA-Seq under identified stress conditions

    • Compare wild-type vs. YqhA mutant stress response profiles

    • Identify differentially regulated pathways and potential compensatory mechanisms

  • Genetic interaction mapping:

    • Create double-knockout strains combining YqhA deletion with other stress response genes

    • Screen for synthetic phenotypes indicating pathway interactions

    • Construct a genetic interaction network centered on YqhA

  • In vivo relevance:

    • Develop infection models that incorporate relevant stressors

    • Compare colonization and persistence of wild-type vs. YqhA mutants

    • Correlate in vitro stress response data with in vivo outcomes

This comprehensive approach would provide both mechanistic insights and biological context for YqhA's function in stress response.

How can researchers investigate potential interactions between YqhA and other virulence factors in Shigella dysenteriae?

To investigate potential interactions between YqhA and Shigella virulence factors, researchers should employ a systematic approach:

  • Co-immunoprecipitation with proteomics:

    • Use tagged YqhA to pull down interaction partners

    • Analyze by mass spectrometry to identify virulence-associated proteins

    • Confirm interactions with reciprocal pull-downs

  • Bacterial two-hybrid screening:

    • Screen YqhA against a library of known virulence factors

    • Quantify interaction strengths between positive hits

    • Map interaction domains through truncation analysis

  • Co-localization studies:

    • Use fluorescence microscopy with differentially labeled proteins

    • Track dynamic associations during infection process

    • Correlate spatial relationships with functional outcomes

  • Genetic epistasis analysis:

    • Create strains with combinations of YqhA and virulence factor mutations

    • Assess whether phenotypes are additive or epistatic

    • Determine hierarchical relationships within virulence pathways

  • Structural studies of protein complexes:

    • Isolate stable complexes between YqhA and virulence partners

    • Determine complex structures through cryo-EM or crystallography

    • Model interaction interfaces and design validation experiments

This approach would reveal whether YqhA functions independently or as part of integrated virulence mechanisms in Shigella dysenteriae.

How might YqhA contribute to antimicrobial resistance mechanisms in Shigella dysenteriae?

Given YqhA's potential role in stress response and the observation that YqhA mutations contribute to inhibitor tolerance in E. coli , investigating its role in antimicrobial resistance is a promising research direction. Researchers should:

  • Compare YqhA sequences between antimicrobial-sensitive and resistant Shigella dysenteriae isolates to identify potential resistance-associated mutations

  • Generate YqhA variants with these mutations and assess their impact on antimicrobial susceptibility profiles

  • Investigate whether YqhA interacts with known resistance mechanisms such as efflux pumps or membrane permeability factors

  • Determine if YqhA expression levels change in response to antimicrobial exposure, which would suggest a role in adaptive resistance

  • Explore whether targeting YqhA could serve as a strategy to restore susceptibility in resistant strains

This research is particularly relevant given that Shigella infections result in an estimated $93 million in direct medical costs for antimicrobial-resistant infections in the United States alone .

What is the potential for YqhA as a therapeutic target in Shigella dysenteriae infections?

The evaluation of YqhA as a therapeutic target should consider:

  • Target validation:

    • Determine if YqhA is essential for virulence or survival under relevant conditions

    • Assess conservation across clinical isolates to ensure broad spectrum activity

    • Evaluate the consequences of YqhA inhibition on bacterial fitness and virulence

  • Druggability assessment:

    • Identify potential binding pockets through structural analysis

    • Screen for small molecule binders using thermal shift assays or other binding methods

    • Develop assays to measure YqhA function that are amenable to high-throughput screening

  • Therapeutic window:

    • Compare YqhA with human proteins to identify structural differences that could be exploited

    • Assess potential off-target effects through proteome-wide binding studies

    • Determine if YqhA inhibition would synergize with existing antibiotics

  • Resistance development:

    • Evaluate the frequency of resistance mutations against YqhA-targeting compounds

    • Determine if resistant variants have reduced fitness or virulence

    • Design combination approaches to minimize resistance development

This research direction has significant potential given the rising antibiotic resistance in Shigella and the estimated 450,000 Shigella infections occurring annually in the United States .

What are the most promising future research directions for understanding YqhA function in Shigella pathogenesis?

The most promising research directions for understanding YqhA's role in Shigella pathogenesis include:

  • Integrated multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics to build comprehensive models of YqhA's role in cellular processes

  • Host-pathogen interaction studies: Investigating how YqhA may influence bacterial interactions with host cells, particularly in epithelial invasion and intercellular spread

  • Evolutionary analysis: Comparing YqhA across Shigella species and related pathogens to understand selective pressures and functional divergence

  • Systems biology modeling: Developing predictive models of YqhA's role in stress response networks that could identify novel intervention points

  • Translational applications: Exploring YqhA as a diagnostic marker or therapeutic target based on fundamental research findings

These directions build upon the current understanding of YqhA as a transmembrane protein potentially involved in stress modulation while addressing the significant public health burden of Shigella infections, particularly the severe disease caused by Shigella dysenteriae type 1 .

How might advances in structural biology techniques improve our understanding of YqhA function?

Emerging structural biology techniques offer unprecedented opportunities to elucidate YqhA function:

  • Cryo-electron microscopy advances: Recent improvements in resolution now enable detailed structural analysis of membrane proteins without crystallization, potentially overcoming the limitations faced in previous homology modeling attempts that achieved only 48% confidence

  • Integrative structural biology: Combining multiple experimental approaches (X-ray crystallography, NMR, SAXS, cross-linking mass spectrometry) to build comprehensive structural models

  • Time-resolved structural studies: Capturing conformational changes in YqhA during stress response or signaling events

  • In-cell structural biology: Determining the structure and interactions of YqhA in its native cellular environment

  • AI-assisted structure prediction: Using tools like AlphaFold2 to generate improved structural models that can guide experimental design and interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.