Recombinant Shigella dysenteriae serotype 1 UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize your specified tag type if provided. Please communicate your requirements.
Synonyms
yfbV; SDY_2491; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: sdy:SDY_2491

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the current understanding of YfbV protein's function in Shigella dysenteriae?

YfbV belongs to the UPF0208 family of membrane proteins found in various Gram-negative bacteria including Shigella species. While its precise function remains under investigation, structural homology analyses suggest potential roles in membrane integrity, transport processes, or virulence. The protein appears to be conserved across Shigella species, with homologs present in S. sonnei and other enterobacteria . Research approaches to determine function typically include gene knockout studies combined with phenotypic characterization, protein-protein interaction mapping, and comparative genomics across related bacterial species.

How is YfbV typically localized within the bacterial cell?

YfbV is predicted to be an inner membrane protein with multiple transmembrane domains. Experimental topology determination methods such as PhoA and GFP fusion reporter systems have been successfully applied to similar membrane proteins in E. coli and can be adapted for YfbV characterization . These techniques rely on the principle that PhoA is enzymatically active only when located in the periplasm, while GFP fluoresces efficiently only in the cytoplasm. By generating C-terminal fusions of these reporters to YfbV and measuring their respective activities, researchers can determine the orientation of the protein within the membrane . Most UPF0208 family proteins exhibit a cytoplasmic C-terminus, but experimental verification for S. dysenteriae YfbV is essential for accurate topology mapping.

What sequence homology does YfbV share with proteins in other bacterial species?

YfbV demonstrates significant sequence conservation within the Enterobacteriaceae family. Bioinformatic analyses reveal homologs in closely related species like E. coli, Shigella sonnei, and Shigella flexneri . Sequence alignment studies typically show >90% identity among Shigella species and >85% identity with E. coli homologs. This high conservation suggests an important physiological role. To determine evolutionary relationships, researchers should employ multiple sequence alignment tools (MUSCLE, CLUSTAL), followed by phylogenetic tree construction using maximum likelihood or Bayesian inference methods. Conservation patterns can provide clues about functionally important domains within the protein structure.

What expression systems are most effective for recombinant YfbV production?

Recombinant production of membrane proteins presents significant challenges due to their hydrophobic nature and complex folding requirements. For YfbV, several expression systems have been employed with varying success:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli (BL21)Cost-effective, rapid growthInclusion body formation common0.5-2 mg/L
E. coli C43(DE3)Specialized for membrane proteinsRequires optimization1-5 mg/L
Yeast (P. pastoris)Post-translational modificationsLonger production time2-8 mg/L
BaculovirusHigher eukaryotic processingComplex setup, expensive5-10 mg/L

E. coli-based systems remain the first choice for initial expression trials . The protein can be expressed with various fusion tags (His6, MBP, GST) to facilitate purification. For membrane proteins like YfbV, expression protocols typically involve lower induction temperatures (16-20°C), reduced inducer concentrations, and specialized E. coli strains designed for membrane protein expression such as C43(DE3) or Lemo21(DE3). Proper folding can be enhanced by co-expression with molecular chaperones or by using cell-free expression systems.

How can researchers optimize membrane extraction and purification of recombinant YfbV?

Purification of membrane proteins requires specialized protocols that maintain protein structure and function. For YfbV, a methodical approach includes:

  • Membrane fraction isolation: After cell disruption (typically by sonication or high-pressure homogenization), differential centrifugation separates membrane fractions from cytosolic components.

  • Detergent screening: A critical step involves identifying optimal detergents for solubilization. Initial screens should include mild detergents (DDM, LMNG, OG) at concentrations just above their critical micelle concentration.

  • Affinity chromatography: His-tagged YfbV can be purified using immobilized metal affinity chromatography (IMAC) with detergent present throughout purification.

  • Size exclusion chromatography: This final polishing step separates monomeric protein from aggregates and removes residual contaminants.

The choice of detergent is particularly critical—most researchers begin with a panel of 6-8 detergents to identify optimal solubilization conditions while preserving native fold. Validation of proper folding can be assessed through circular dichroism spectroscopy to confirm secondary structure content expected for a membrane protein .

What are the critical quality control measures for verifying recombinant YfbV integrity?

Quality assessment of purified YfbV should include multiple orthogonal techniques:

  • SDS-PAGE and Western blotting: Confirms protein identity, purity, and approximate molecular weight. For membrane proteins, anomalous migration patterns are common due to detergent binding.

  • Mass spectrometry: Peptide mass fingerprinting and intact mass analysis verify sequence integrity and detect post-translational modifications.

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content, expected to show characteristic alpha-helical patterns typical of transmembrane domains.

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Determines oligomeric state and homogeneity in solution.

  • Thermal stability assays: Techniques like differential scanning fluorimetry can assess protein stability under various buffer conditions.

For functional validation, researchers must develop assays specific to the putative function of YfbV, which might include transport assays, interaction studies, or in vivo complementation experiments in knockout strains .

What experimental approaches can determine the membrane topology of YfbV?

Membrane topology determination is essential for understanding protein function. For YfbV, several complementary approaches can be employed:

  • Reporter fusion analysis: The PhoA/GFP dual reporter system has been successfully applied to many membrane proteins including those in E. coli. By creating a series of truncated YfbV constructs fused to either PhoA or GFP, researchers can map the orientation of each segment relative to the membrane . This technique has been adapted to high-throughput formats using microtiter plates for rapid analysis.

  • Cysteine scanning mutagenesis: Introducing cysteine residues at specific positions followed by labeling with membrane-impermeable sulfhydryl reagents can reveal exposed regions.

  • Protease protection assays: Limited proteolysis of membrane preparations, followed by mass spectrometry, can identify protected transmembrane regions versus exposed loops.

  • Computational prediction refinement: Tools like TMHMM can be improved by incorporating experimental constraints from C-terminal reporter fusions, increasing prediction accuracy from approximately 70% to 80% .

The combination of these methods provides a robust topology model. The experimental approach used for E. coli inner membrane proteins has shown success rates of approximately 90%, suggesting it would be highly applicable to YfbV characterization .

How can researchers investigate the three-dimensional structure of YfbV?

Determining the 3D structure of membrane proteins remains challenging but several approaches are applicable to YfbV:

  • X-ray crystallography: Requires production of stable, homogeneous protein crystals. For membrane proteins like YfbV, crystallization in lipidic cubic phases has shown success in related proteins.

  • Cryo-electron microscopy (cryo-EM): Increasingly popular for membrane proteins, especially those refractory to crystallization. For smaller proteins like YfbV, advances in detector technology now allow structure determination of proteins below 100 kDa.

  • Nuclear magnetic resonance (NMR) spectroscopy: Solution NMR is challenging for full-length membrane proteins, but solid-state NMR approaches can provide structural constraints.

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linking coupled with mass spectrometry analysis can provide distance constraints to inform structural models.

  • Small-angle X-ray scattering (SAXS): Provides low-resolution envelope information in a near-native environment.

Integrative structural biology approaches combining multiple techniques with computational modeling often yield the most reliable structural insights for challenging membrane proteins like YfbV.

What evidence exists for YfbV's role in Shigella pathogenesis?

While direct evidence for YfbV's role in pathogenesis requires further investigation, several research approaches can be employed:

  • Gene knockout studies: Creating yfbV deletion mutants in S. dysenteriae and assessing changes in virulence using cell invasion assays, animal infection models, and transepithelial resistance measurements.

  • Transcriptional analysis: Examining yfbV expression under infection-relevant conditions (pH stress, bile exposure, low oxygen) using qRT-PCR or RNA-seq methodologies.

  • Interaction proteomics: Identifying binding partners of YfbV through techniques like affinity purification coupled with mass spectrometry (AP-MS) or bacterial two-hybrid systems.

  • Comparative genomics: Analyzing conservation and selection pressure on yfbV across clinical isolates with varying virulence properties.

S. dysenteriae serotype 1 produces severe illness and is associated with epidemic dysentery, suggesting its virulence factors, potentially including YfbV, may have significant roles in pathogenesis . The emergence of extensively drug-resistant (XDR) Shigella strains further emphasizes the importance of understanding all potential virulence factors and drug targets.

How might YfbV be incorporated into vaccine development strategies?

Membrane proteins like YfbV represent potential targets for vaccine development through several approaches:

  • Subunit vaccines: Recombinant production of YfbV or immunogenic epitopes from its structure could serve as vaccine antigens if shown to elicit protective immunity. This approach requires careful epitope mapping to identify surface-exposed regions accessible to antibodies.

  • Glycoconjugate approaches: Similar to the strategy employed for S. flexneri 2a vaccines, YfbV could potentially be used as a carrier protein for O-polysaccharide antigens. In such glycoconjugate vaccines, bacterial oligosaccharyltransferases like PglB from C. jejuni can transfer polysaccharide antigens to carrier proteins in recombinant E. coli systems .

  • Reverse vaccinology: Computational analysis of YfbV sequence for potential B-cell and T-cell epitopes can guide rational epitope-based vaccine design.

  • Live attenuated vaccine platforms: YfbV epitopes could be expressed in attenuated bacterial vectors as part of a multivalent vaccine strategy.

For S. dysenteriae specifically, the development of glycoconjugate vaccines has shown promise, with optimization strategies including sequential induction of protein expression and addition of specific monosaccharides like N-acetylglucosamine improving yields up to 3.1-fold in experimental settings .

What challenges exist in targeting YfbV for therapeutic development?

Several technical and biological challenges must be addressed:

  • Membrane localization: The embedded nature of YfbV within the bacterial membrane can limit accessibility to antibodies, requiring careful epitope selection from exposed regions.

  • Antigenic variation: Assessment of sequence conservation across clinical isolates is essential to ensure broad protection against diverse strains.

  • Immune response characterization: Determining whether YfbV elicits primarily humoral or cellular immunity is critical for vaccine formulation and adjuvant selection.

  • Cross-reactivity concerns: Potential homology with human proteins must be evaluated to prevent autoimmune responses.

  • Stability and formulation: Membrane proteins often present challenges in maintaining native structure during purification and storage, requiring specialized stabilization strategies.

For Shigella vaccines in general, the existence of multiple species and serotypes (S. dysenteriae, S. flexneri, S. boydii, and S. sonnei) complicates vaccine development, with S. flexneri being the most frequently isolated species worldwide (approximately 60% of cases) .

How can interactome mapping reveal YfbV's functional network in Shigella?

Understanding YfbV's protein-protein interactions can provide critical insights into its function through several methodologies:

  • Proximity-dependent biotin identification (BioID): Fusing YfbV to a biotin ligase enables labeling of proximal proteins in the native cellular environment, followed by streptavidin-based purification and mass spectrometry identification.

  • Membrane-based yeast two-hybrid (MYTH): Specifically designed for membrane proteins, this system can detect interactions between YfbV and other membrane or soluble proteins.

  • Co-immunoprecipitation coupled with mass spectrometry: Using antibodies against tagged YfbV to pull down interaction partners from solubilized membranes.

  • Cross-linking mass spectrometry: Chemical cross-linking stabilizes transient interactions before analysis by mass spectrometry, providing both interaction data and spatial constraints.

  • Genetic interaction mapping: Synthetic genetic array (SGA) analysis or transposon-sequencing approaches can identify genes that functionally interact with yfbV.

The interactome data should be analyzed in the context of known virulence networks in Shigella, potentially revealing connections to established pathogenicity mechanisms such as the type III secretion system or intracellular survival strategies.

What specialized techniques are emerging for studying membrane proteins like YfbV?

Recent technological advances have expanded the toolbox for membrane protein research:

  • Nanodiscs and SMALPs (Styrene Maleic Acid Lipid Particles): These systems enable studying membrane proteins in more native-like lipid environments compared to detergent micelles, potentially preserving functional states.

  • Single-molecule techniques: Approaches like single-molecule FRET or atomic force microscopy can provide insights into conformational dynamics and structural heterogeneity not accessible through ensemble methods.

  • High-throughput screening platforms: Microfluidic systems coupled with fluorescence detection enable rapid screening of stability conditions or ligand interactions for membrane proteins.

  • Cryo-electron tomography: For in situ structural studies, examining YfbV within the native membrane context at molecular resolution.

  • Integrative modeling: Combining sparse experimental data with advanced computational approaches to generate structural models when high-resolution structures remain elusive.

These emerging methods could be particularly valuable for YfbV characterization given the challenges inherent to membrane protein research and the limited direct experimental data currently available.

How might YfbV contribute to antimicrobial resistance mechanisms in S. dysenteriae?

With the emergence of extensively drug-resistant (XDR) Shigella strains reported by the CDC , understanding potential contributions of membrane proteins to resistance mechanisms becomes critically important:

  • Efflux pump associations: YfbV could potentially interact with or modulate efflux systems that export antibiotics from bacterial cells. Research approaches include co-purification studies and functional assays measuring antibiotic accumulation in wild-type versus yfbV knockout strains.

  • Membrane permeability alterations: Changes in membrane protein composition can affect the penetration of antimicrobial compounds. Lipidomic and membrane fluidity analyses comparing wild-type and yfbV-modulated strains can reveal such effects.

  • Stress response networks: YfbV might participate in stress responses that indirectly contribute to antibiotic tolerance. Transcriptomic and proteomic analyses under antibiotic exposure can identify potential roles.

  • Biofilm formation: If YfbV influences biofilm development, it could contribute to the inherently higher antibiotic tolerance of bacteria in biofilms. Crystal violet staining assays and confocal microscopy of biofilm formation in yfbV mutants would address this possibility.

XDR Shigella bacteria are resistant to all generally recommended antibiotics currently used in the United States, making infections difficult to treat . Understanding the full complement of proteins potentially involved in resistance mechanisms, including membrane proteins like YfbV, may reveal new therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.