Recombinant Shigella dysenteriae serotype 1 UPF0259 membrane protein yciC (yciC)

What is the structural composition of Shigella dysenteriae serotype 1 UPF0259 membrane protein yciC?

The yciC protein (UniProt ID: Q32GT9) is a membrane protein consisting of 247 amino acids with a molecular sequence: MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGImLVVVPGIIMAILLAPAPVmLVQDKMGVFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAVLLIYLFR LYmLIRQ .

Based on hydropathy analysis, the protein contains multiple transmembrane domains characterized by hydrophobic amino acid stretches that anchor it within the bacterial membrane. The protein's structure suggests it may function in membrane transport or signaling, consistent with its classification as a UPF0259 family member.

How is the yciC gene regulated in bacterial systems?

While specific regulation in S. dysenteriae is still being elucidated, research in related bacterial systems like Bacillus subtilis offers valuable insights. In B. subtilis, yciC is regulated by the zinc uptake regulator (Zur) protein as part of zinc homeostasis mechanisms .

The regulatory region contains two functional Zur boxes: a primary site (C2) that overlaps with a σA promoter approximately 200 bp upstream of yciC, and a secondary site (C1) near the translational start point. Zur binds to both these sites to mediate strong, zinc-dependent repression of yciC . This dual-binding mechanism allows for precise control of expression in response to environmental zinc availability.

What is the potential functional role of yciC in Shigella pathogenesis?

Based on comparative proteomic analyses of Shigella species, yciC likely plays a role in bacterial survival under stress conditions encountered during host infection. Membrane proteins in Shigella dysenteriae often function in maintaining cellular homeostasis during pathogenesis .

The yciC protein may function as a metallochaperone , potentially involved in metal ion (particularly zinc) trafficking within bacterial cells. During infection, pathogens must compete with the host for essential metal ions, making metal homeostasis proteins critical virulence determinants. Proteome analysis of S. dysenteriae reveals that numerous membrane proteins show differential expression in vivo versus in vitro, suggesting their importance in adaptation to the host environment .

How can researchers optimize expression systems for recombinant yciC protein production?

For optimal expression of recombinant S. dysenteriae yciC, researchers should consider the following methodological approach:

Table 1: Optimization Parameters for Recombinant yciC Expression

For membrane proteins like yciC, successful recombinant expression requires careful optimization of solubilization conditions. Consider using a detergent screening approach including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin at various concentrations to identify optimal extraction conditions.

What experimental approaches are most effective for studying yciC protein interactions with zinc?

To investigate yciC-zinc interactions, researchers should employ a multi-methodological approach:

• Isothermal Titration Calorimetry (ITC): Provides direct measurement of binding thermodynamics between purified yciC and zinc ions.

• Fluorescence Spectroscopy: Using zinc-specific fluorophores to monitor conformational changes in yciC upon zinc binding.

• Site-Directed Mutagenesis: Systematic mutation of potential metal-coordinating residues (histidine, cysteine) followed by functional assays to identify critical zinc-binding sites.

• Electrophoretic Mobility Shift Assay (EMSA): To study potential interactions between yciC and Zur or other regulatory proteins, following protocols similar to those used in B. subtilis studies .

When designing zinc-binding experiments, researchers should account for potential competing metal ions by incorporating EDTA pre-treatment followed by dialysis before zinc exposure. Control experiments with other divalent cations (Mg²⁺, Ca²⁺, Fe²⁺) are essential to establish binding specificity.

How can researchers assess the contribution of yciC to Shigella dysenteriae virulence in experimental models?

To evaluate yciC's role in virulence, implement a systematic approach combining molecular genetics with infection models:

• Gene Knockout Construction: Generate a clean deletion of yciC using lambda Red recombination or CRISPR-Cas systems, followed by complementation with wild-type and mutant alleles.

• In Vitro Cellular Assays: Compare wild-type and ΔyciC strains for:

  • Invasion efficiency in epithelial cell lines

  • Intracellular multiplication rates

  • Intercellular spread capabilities

  • Survival under acid stress conditions (mimicking gut environment)

• Animal Infection Models: The gnotobiotic piglet model has been established for studying S. dysenteriae pathogenesis . Compare colonization, tissue damage, and bacterial recovery between wild-type and mutant strains.

• Transcriptomic Analysis: Perform RNA-Seq on wild-type and ΔyciC strains under various stress conditions to identify downstream effects of yciC deletion on global gene expression.

Importantly, researchers should integrate proteomic approaches similar to those used in previous S. dysenteriae studies to identify changes in protein abundance and post-translational modifications resulting from yciC deletion.

What are the key considerations when designing antibodies against yciC for immunological studies?

When developing antibodies against yciC for research applications, researchers should consider:

Epitope Selection Strategy:

• Analyze the protein sequence to identify exposed, hydrophilic regions using bioinformatic tools (Kyte-Doolittle plots).

• Select peptide regions with high antigenicity scores that are unique to S. dysenteriae yciC.

• Avoid transmembrane domains, which are poorly immunogenic and may cross-react with other membrane proteins.

Recommended Approach:
Generate antibodies against both N-terminal and C-terminal peptides, as these regions are typically more exposed and accessible. Based on the yciC sequence , the N-terminal region (amino acids 1-25) contains hydrophilic residues suitable for antibody production.

For validation, implement Western blotting against both recombinant yciC and native protein from S. dysenteriae lysates, including appropriate controls (pre-immune serum, peptide competition).

What protocols are recommended for studying differential expression of yciC under various environmental conditions?

To investigate yciC expression under different conditions:

• qRT-PCR Analysis:

  • Design primers specific to yciC coding region

  • Use validated reference genes (rpoD, gyrA) for normalization

  • Test expression under varying zinc concentrations, pH levels, and oxygen availability

• Reporter Gene Fusions:

  • Construct transcriptional and translational fusions with reporter genes (gfp, lacZ)

  • Measure activity under in vitro conditions mimicking host environment

• Proteomics Approach:

  • Implement stable isotope labeling (SILAC) for quantitative comparison

  • Compare protein abundance in bacteria grown in vitro versus isolated from infection models

  • Analyze post-translational modifications that may regulate yciC activity

Table 2: Recommended Conditions for yciC Expression Analysis

This comprehensive approach enables detection of subtle regulatory mechanisms governing yciC expression during infection.

How should researchers interpret proteomics data involving yciC in the context of Shigella pathogenesis?

When analyzing proteomics data involving yciC:

Previous proteomic studies identified 1,061 distinct gene products from S. dysenteriae . When analyzing yciC, researchers should position it within this broader proteome context, particularly noting its relationship to proteins involved in stress response and virulence.

What bioinformatic approaches can predict structure-function relationships for yciC?

For structure-function prediction of yciC:

• Homology Modeling:

  • Identify structural homologs using HHpred or Phyre2

  • Build molecular models based on related UPF0259 family proteins

  • Validate models using energy minimization and Ramachandran plots

• Molecular Dynamics Simulations:

  • Simulate protein behavior in a lipid bilayer environment

  • Analyze conformational changes in response to zinc binding

  • Identify potential interaction surfaces and functional domains

• Evolutionary Analysis:

  • Perform multiple sequence alignment of yciC homologs across bacterial species

  • Identify conserved residues suggesting functional importance

  • Apply coevolution analysis to predict interacting residue pairs

• Functional Site Prediction:

  • Use tools like ConSurf to map conservation onto structural models

  • Predict ligand-binding sites using CASTp or COACH

These computational approaches generate testable hypotheses about yciC function that can guide experimental design, particularly for site-directed mutagenesis studies targeting predicted functional residues.

How can researchers design definitive experiments to determine if yciC functions as a metallochaperone in Shigella dysenteriae?

Based on evidence suggesting yciC may function as a metallochaperone , the following experimental design would provide conclusive evidence:

• Metal Binding Characterization:

  • Purify recombinant yciC and perform inductively coupled plasma mass spectrometry (ICP-MS) to identify bound metals

  • Measure binding affinities for various metals (Zn²⁺, Cu²⁺, Fe²⁺, Mn²⁺) using isothermal titration calorimetry

  • Determine metal:protein stoichiometry through equilibrium dialysis

• Metal Transfer Assays:

  • Design in vitro assays using purified yciC and potential partner proteins

  • Monitor metal transfer using competitive chelators and fluorescent probes

  • Quantify transfer rates under various conditions (pH, temperature, redox state)

• Structural Studies with Metal Binding:

  • Perform X-ray crystallography or cryo-EM on yciC with and without bound metals

  • Map conformational changes associated with metal binding

  • Identify coordinating residues through anomalous scattering

• In Vivo Metal Trafficking:

  • Create fluorescently tagged yciC variants

  • Track localization during metal stress conditions

  • Measure intracellular metal distribution in wild-type versus ΔyciC strains

This experimental framework would establish whether yciC functions specifically in metal homeostasis and would characterize the mechanism of its metallochaperone activity.

What are recommended controls for studying yciC function in Shigella dysenteriae infection models?

Essential Genetic Controls:

• Wild-type strain: Unmodified S. dysenteriae serotype 1

• ΔyciC deletion mutant: Clean deletion without antibiotic markers

• Complemented strain: ΔyciC with yciC expression restored from plasmid

• Point mutant controls: Strains with mutations in predicted functional residues

• Over-expression strain: yciC expressed from inducible promoter

Experimental Controls:

• Known virulence mutants: Strains lacking established virulence factors (e.g., ΔipaB) as reference points

• Related membrane protein mutants: To distinguish specific from general membrane protein effects

• Heat-killed bacteria: To differentiate active infection from passive immune stimulation

• Multiple host cell lines: Test various epithelial and immune cell types

Table 3: Control Matrix for yciC Functional Studies

Implementing these controls ensures that observed phenotypes can be specifically attributed to yciC function rather than to experimental artifacts or general disruptions.