Recombinant Shigella dysenteriae serotype 1 UPF0283 membrane protein YcjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant YcjF

Recombinant YcjF is a 344-amino acid membrane protein encoded by the ycjF gene (locus SDY_1400) in Shigella dysenteriae serotype 1 (strain Sd197) . It belongs to the UPF0283 family of uncharacterized membrane proteins and is associated with bacterial physiology under stress conditions . The recombinant form is expressed in heterologous systems like E. coli and yeast for biochemical studies .

Production Methods

Recombinant YcjF is available in multiple formats across expression platforms:

Product CodeExpression SystemTagProtein LengthPurity
CSB-EP655528SGF1E. coliVariablePartial>85% (SDS-PAGE)
CSB-YP655528SGF1YeastVariablePartial>85%
RFL23641SFE. coliHis-tagFull-length (1-344)>90%

Notes: Tag type (e.g., His, GST) is determined during manufacturing . Lyophilized or liquid formulations are stabilized in Tris/PBS buffers with 50% glycerol .

Research Applications

  • ELISA Development: Used as an antigen for antibody generation .

  • Proteomic Studies: Part of S. dysenteriae membrane subproteomes under stress .

  • Vaccine Research: Homologs in S. boydii are explored as vaccine targets .

  • Functional Analysis: Investigated for roles in acid stress response and biofilm formation .

Proteomic and Pathogenic Insights

In vivo proteomic profiling of S. dysenteriae reveals:

  • Acid Stress Response: Co-expression with GadB (glutamate decarboxylase) and HdeA (chaperone) during host colonization .

  • Virulence Context: Co-localized with type III secretion system (T3SS) effectors like IpaB/IpaC, though YcjF’s direct role remains unconfirmed .

Limitations and Future Directions

  • Functional Data: No direct evidence links YcjF to virulence; studies focus on structural characterization .

  • Expression Challenges: Partial sequences may lack functional domains .

  • Therapeutic Potential: Requires further exploration in animal models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ycjF; SDY_1400; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNACQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRVFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETL
Uniprot No.

Target Background

Database Links

KEGG: sdy:SDY_1400

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0283 membrane protein YcjF and its significance in Shigella dysenteriae?

The UPF0283 membrane protein YcjF (ycjF) is a membrane-associated protein from Shigella dysenteriae serotype 1, consisting of 344 amino acids. The "UPF" designation indicates an uncharacterized protein family, suggesting its full functional characterization remains incomplete .

Methodologically, researchers typically approach uncharacterized membrane proteins through:

  • Sequence analysis and homology modeling to predict function

  • Subcellular localization studies using GFP fusion constructs

  • Knockout/knockdown experiments to observe phenotypic changes

  • Protein-protein interaction studies to identify binding partners

While specific functional studies on YcjF remain limited in the literature, membrane proteins in pathogenic bacteria often play critical roles in cell integrity, nutrient transport, signaling, and host-pathogen interactions, making them valuable research targets.

How should researchers properly reconstitute and store recombinant YcjF protein?

Proper reconstitution and storage of recombinant YcjF protein requires careful attention to maintain structural integrity and functionality:

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening to collect contents

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store at -20°C/-80°C for long-term preservation

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can compromise protein integrity

The protein is lyophilized and supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability. Trehalose is a disaccharide that protects proteins during freeze-drying and subsequent storage by preventing denaturation.

What experimental approaches can be used to study the membrane localization of YcjF?

To study the membrane localization of YcjF, researchers can employ several complementary approaches:

  • Subcellular fractionation:

    • Disrupt bacterial cells using techniques like sonication or French press

    • Separate cellular components through differential centrifugation

    • Isolate membrane fractions using sucrose gradient ultracentrifugation

    • Confirm YcjF presence in membrane fractions via Western blotting

  • Immunofluorescence microscopy:

    • Generate specific antibodies against YcjF or utilize the His-tag

    • Fix and permeabilize bacterial cells

    • Perform immunostaining with primary antibodies against YcjF

    • Visualize using fluorescently-labeled secondary antibodies

  • Fusion protein approaches:

    • Create YcjF-GFP or YcjF-mCherry fusion constructs

    • Express in Shigella or E. coli model systems

    • Observe localization patterns via fluorescence microscopy

    • Compare with known membrane protein markers

  • Membrane topology mapping:

    • Use reporter fusion techniques (PhoA/LacZ)

    • Employ protease accessibility assays with intact versus permeabilized cells

    • Implement cysteine scanning mutagenesis with membrane-impermeable labeling reagents

These approaches provide complementary data to establish the precise membrane localization and topology of YcjF within the bacterial cell.

What are the recommended conditions for expression and purification of recombinant YcjF?

The optimal expression and purification conditions for recombinant YcjF protein involve:

ParameterRecommended ConditionNotes
Expression hostE. coliCompatible with membrane protein expression
Expression vectorpET or similar with His-tagN-terminal His-tag facilitates purification
InductionIPTG, typically 0.5-1.0 mMTemperature optimization recommended
Growth temperature16-25°C post-inductionLower temperatures may improve folding
Lysis bufferTris/PBS-based with protease inhibitorsMembrane proteins require detergent
DetergentMild non-ionic (e.g., DDM, CHAPS)Critical for membrane protein solubilization
Purification methodNi-NTA affinity chromatographyUtilizing His-tag for capture
Secondary purificationSize exclusion chromatographyImproves purity and removes aggregates
Purity assessmentSDS-PAGEShould achieve >90% purity

The commercial recombinant protein is expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE . For researchers performing their own expression, optimization of detergent type and concentration is often critical for maintaining native structure of membrane proteins.

How might YcjF protein be utilized in Shigella vaccine development research?

YcjF could contribute to Shigella vaccine development through several research pathways:

  • Antigen discovery and validation:

    • Evaluate YcjF immunogenicity in animal models

    • Assess conservation across Shigella serotypes

    • Determine surface accessibility using antibody binding studies

    • Analyze protective potential through challenge studies

  • Integration with bioconjugate vaccine approaches:

    • The bioconjugation technology, which has shown promise for Shigella vaccines, allows production of conjugate vaccines in a biological environment to preserve native immunogenic structures

    • YcjF could potentially be evaluated as a carrier protein alternative to the currently used EPA (exoprotein A)

    • Comparative studies with established carrier proteins would be needed to assess its efficacy

  • Epitope mapping and structure-based design:

    • Identify immunodominant epitopes within YcjF

    • Engineer constructs displaying multiple epitopes

    • Design YcjF-derived peptides for inclusion in subunit vaccines

  • Combination with O-antigen approaches:

    • Current advanced Shigella vaccines focus on O-antigen conjugates

    • YcjF could be investigated as a complementary antigen to enhance coverage or protection

    • Studies would need to evaluate whether combining protein antigens with O-antigen conjugates provides synergistic protection

This approach aligns with the WHO priority for Shigella vaccine development, particularly given the increasing antibiotic resistance observed in Shigella strains globally .

What techniques can be employed to investigate the functional role of YcjF in Shigella pathogenesis?

Investigating YcjF's role in Shigella pathogenesis requires multiple complementary approaches:

  • Genetic manipulation studies:

    • Generate ycjF knockout mutants using CRISPR-Cas9 or homologous recombination

    • Create conditional expression systems for temporal control

    • Develop complementation strains to confirm phenotype specificity

    • Perform site-directed mutagenesis of key residues

  • Virulence assessments:

    • Compare wild-type and ycjF mutant strains in:

      • Cell invasion assays using epithelial cell lines

      • Intracellular replication studies

      • Cell-to-cell spread capabilities

      • Inflammatory response induction

  • In vivo infection models:

    • Mouse pulmonary infection model

    • Guinea pig keratoconjunctivitis model

    • Infant rabbit model of shigellosis

    • Monitor bacterial burden, histopathology, and host immune responses

  • Host-pathogen interaction studies:

    • Identify host cell binding partners using pull-down assays

    • Perform bacterial two-hybrid screening

    • Utilize proximity labeling techniques (BioID/APEX)

    • Conduct co-immunoprecipitation followed by mass spectrometry

  • Transcriptomic analysis:

    • RNA-Seq of wild-type vs. ycjF mutant under various conditions

    • qRT-PCR validation of differentially expressed genes

    • ChIP-Seq if regulatory functions are suspected

These multidisciplinary approaches collectively would provide insights into whether YcjF contributes to key pathogenic processes in Shigella dysenteriae.

How can researchers assess cross-reactivity of anti-YcjF antibodies with related proteins from other Shigella serotypes?

Assessing cross-reactivity of anti-YcjF antibodies with related proteins from other Shigella serotypes involves:

  • Sequence and structural analysis:

    • Perform multiple sequence alignment of YcjF homologs across Shigella serotypes

    • Identify conserved and variable regions

    • Predict potential epitopes using computational tools

    • Generate conservation heat maps to guide experimental design

  • Recombinant protein production:

    • Express YcjF homologs from multiple Shigella serotypes

    • Ensure consistent expression and purification methods

    • Verify protein integrity via circular dichroism or other structural analyses

    • Prepare standardized protein panels for comparative studies

  • Cross-reactivity assessment methods:

MethodApplicationData Analysis
ELISAQuantitative binding assessmentCalculate EC50 values and establish affinity hierarchies
Western blottingSize verification and specificityCompare band intensities across serotypes
Surface plasmon resonanceReal-time binding kineticsDetermine kon/koff rates and KD values
Peptide arraysEpitope mappingIdentify shared and unique binding regions
Flow cytometryCell-surface binding evaluationCompare MFI values across intact bacteria
  • Serum absorption studies:

    • Pre-absorb antibodies with homologous proteins

    • Evaluate remaining reactivity against panel of YcjF variants

    • Determine unique and shared epitopes across serotypes

This systematic approach would establish whether antibodies generated against S. dysenteriae serotype 1 YcjF recognize homologous proteins in other Shigella serotypes, which has implications for both diagnostic development and vaccine design.

What are the challenges in structural characterization of YcjF and how can they be addressed?

Structural characterization of membrane proteins like YcjF presents several challenges with specific methodological solutions:

  • Challenges in crystallization:

    • Membrane proteins are notoriously difficult to crystallize

    • Solution: Screen multiple detergents, lipidic cubic phases, antibody fragments as crystallization chaperones, and nanodiscs

    • Implement high-throughput crystallization screening with specialized membrane protein screens

    • Consider fusion protein strategies (e.g., T4 lysozyme insertion) to enhance crystallization propensity

  • NMR spectroscopy challenges:

    • Size limitations for traditional solution NMR

    • Solution: Utilize solid-state NMR, selective isotope labeling, and TROSY-based methods

    • Fragment-based approaches focusing on specific domains

    • Detergent micelle optimization to minimize spectrum broadening

  • Cryo-EM approaches:

    • Size challenges for smaller membrane proteins

    • Solution: Antibody decoration, multimerization strategies, or scaffold proteins

    • Use of phase plates to enhance contrast

    • Implementation of new direct electron detectors and motion correction algorithms

  • Computational prediction:

    • Limited homology to characterized proteins

    • Solution: Deep learning approaches (AlphaFold2, RoseTTAFold)

    • Coevolutionary analysis and contact prediction

    • Integration of sparse experimental data with molecular dynamics simulations

  • Functional validation of structures:

    • Correlating structure with function

    • Solution: Site-directed mutagenesis of key residues identified in structural models

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Disulfide crosslinking to validate proximity predictions

These methodologies, applied systematically, can address the significant challenges inherent to membrane protein structural biology and provide insights into YcjF structure-function relationships.

How can YcjF be used in studying antimicrobial resistance mechanisms in Shigella dysenteriae?

YcjF can serve as a model system for investigating antimicrobial resistance mechanisms in Shigella dysenteriae through several research approaches:

  • Structure-based drug design:

    • If YcjF is found to be essential, its structure could inform development of novel antimicrobials

    • Virtual screening against structural models to identify potential inhibitors

    • Fragment-based drug discovery targeting specific binding pockets

    • Rational design of peptidomimetics that interfere with YcjF function

  • Resistance mechanism studies:

    • Evaluate whether YcjF expression levels change in response to antibiotic exposure

    • Assess if YcjF contributes to membrane permeability or efflux pump regulation

    • Determine if mutations in ycjF correlate with resistance phenotypes

    • Investigate potential interactions with known resistance determinants

  • Experimental evolution approaches:

    • Subject wild-type and ycjF-modified strains to increasing antibiotic concentrations

    • Sequence evolved strains to identify compensatory mutations

    • Characterize fitness costs of resistance mutations in different genetic backgrounds

    • Reconstruct identified mutations to confirm their contribution to resistance

  • Clinical isolate characterization:

    • Sequence ycjF in antibiotic-resistant clinical isolates

    • Correlate sequence variations with resistance profiles

    • Perform functional studies on variant YcjF proteins

    • Develop diagnostic markers if specific variations associate with resistance

This research direction is particularly relevant given that Shigella has acquired resistance to many antibiotics, making treatment more difficult and expensive. The CDC considers antibiotic-resistant Shigella a serious threat, with approximately 77,000 resistant Shigella infections reported annually in the United States .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.