Recombinant Shigella dysenteriae serotype 1 UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant YjjB is typically expressed in Escherichia coli with an N-terminal His-tag for affinity purification. Key production details include:

ParameterSpecification
Expression SystemE. coli
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE)
FormulationLyophilized powder in Tris/PBS buffer with 6% trehalose
Storage-20°C/-80°C; avoid freeze-thaw cycles

3.1. Vaccine Development

  • YjjB is listed among novel subunit vaccine candidates for S. dysenteriae due to its surface exposure and immunogenicity in animal models .

  • In piglet antisera studies, YjjB elicited antigen-specific antibodies, suggesting potential for inclusion in multivalent vaccines .

3.2. Functional Studies

  • Acid Stress Response: UPF0442 family proteins in Shigella are upregulated during host infection, potentially aiding in pH homeostasis or oxidative stress resistance .

  • Pathogen-Host Interactions: YjjB may contribute to bacterial survival in the gut mucosa, though direct evidence is lacking .

Challenges and Knowledge Gaps

  • Function Unknown: Despite homology to stress-response proteins in E. coli and Salmonella, YjjB’s precise biochemical role in Shigella remains uncharacterized .

  • Limited Data: Most studies focus on S. flexneri YjjB homologs, leaving S. dysenteriae YjjB understudied .

Comparative Analysis with Related Proteins

FeatureS. dysenteriae YjjBS. flexneri YjjB
UniProt IDQ327N3 Q83ZW2
Amino Acid Length157 157
Expression HostE. coli E. coli
Vaccine PotentialProposed Under evaluation

Future Directions

  • Functional Characterization: Knockout studies to define YjjB’s role in virulence or metabolism.

  • Preclinical Trials: Testing YjjB as a subunit vaccine component alongside established antigens like IpaB or OmpA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate special requirements for the format. Please specify your desired format during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yjjB; SDY_4617; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
yjjB
Target Protein Sequence
MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVQALRWCALLGSIGHGSRMILMTSGLNIE WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP LMITLLTNFLTASSIVGALSVDLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: sdy:SDY_4617

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does yjjB compare across different Shigella species and related enterobacteria?

Comparative genomic analysis reveals that yjjB is conserved across multiple Shigella species and related enterobacteria. The protein is found in various Shigella species including S. dysenteriae, S. flexneri, S. sonnei, and S. boydii, as well as in related pathogens such as various Salmonella strains and E. coli .

The conservation of this protein across species suggests potential functional importance, despite its currently uncharacterized status. Sequence alignment studies typically show:

SpeciesSequence Identity to S. dysenteriae yjjBConservation of Key Domains
S. flexneri>90%Complete
S. sonnei>85%Complete
S. boydii>85%Complete
E. coli>80%Complete
Salmonella spp.75-80%Partial

This high degree of conservation suggests that yjjB may play a role in core cellular processes common to these enteric pathogens rather than species-specific virulence functions .

What purification methods are most effective for recombinant yjjB protein?

Purification of recombinant yjjB requires specific methodological considerations due to its membrane-associated properties. The most effective protocol includes:

  • Expression system: Co-expression with a bacterial chaperone may be necessary, similar to how IpaB requires co-expression with its chaperone IpgC .

  • Extraction buffer optimization: A Tris-based buffer with 50% glycerol has proven effective for protein stability .

  • Purification steps:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) if expressed with a histidine tag

    • Size exclusion chromatography for further purification

    • Consideration of detergent inclusion if membrane association is confirmed

  • Storage conditions: Store at -20°C for short-term or -80°C for long-term stability, with aliquoting recommended to avoid freeze-thaw cycles .

When properly purified, the protein maintains its highly α-helical secondary structure, which can be confirmed via circular dichroism spectroscopy.

What experimental approaches can determine the function of yjjB in Shigella dysenteriae pathogenesis?

Determining the function of an uncharacterized protein like yjjB requires a multi-faceted experimental approach:

  • Gene knockout studies:

    • Create precise gene deletions using CRISPR-Cas9 or homologous recombination

    • Assess phenotypic changes in growth, stress response, and virulence

    • Complement with wild-type gene to confirm specificity of observed phenotypes

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and yjjB-deficient strains

    • Identify co-regulated genes that may provide functional clues

    • Examine expression during different infection stages and environmental conditions

  • Protein interaction studies:

    • Perform pull-down assays followed by mass spectrometry to identify binding partners

    • Use bacterial two-hybrid systems to confirm direct protein-protein interactions

    • Examine potential interactions with known virulence factors or invasion proteins

  • Structural biology approaches:

    • Determine 3D structure through X-ray crystallography or cryo-EM

    • Identify structural motifs that suggest function

    • Perform in silico docking studies with potential substrates or interactors

These approaches have been successful in characterizing previously unknown proteins in Shigella species, including those involved in the type three secretion apparatus (T3SA) that are essential for virulence .

How might yjjB contribute to antimicrobial resistance in Shigella dysenteriae?

While the specific role of yjjB in antimicrobial resistance has not been directly established, research on plasmid profiles and resistance patterns in Shigella provides a framework for investigation:

  • Potential mechanisms of involvement:

    • Membrane-associated proteins can contribute to permeability barriers

    • Unknown enzymatic activities might modify antimicrobial compounds

    • Regulatory roles affecting expression of resistance determinants

  • Correlation with resistance patterns:
    Studies of S. dysenteriae type 1 isolates have revealed distinct plasmid patterns between strains isolated from symptomatic and asymptomatic carriers . Experimental approaches to investigate yjjB's role should include:

    • Comparative expression analysis between resistant and susceptible isolates

    • Assessment of yjjB expression in response to antibiotic challenge

    • Evaluation of resistance profiles in yjjB knockout mutants

  • Potential association with R-plasmids:
    Multi-resistant clinical isolates of Shigella often harbor large transmissible plasmids (44-76 MDal) . Investigating whether yjjB interacts with components encoded by these plasmids could reveal roles in resistance mechanisms.

What is the potential of yjjB as a target for novel therapeutics against shigellosis?

Exploring yjjB as a therapeutic target requires assessment of several key factors:

  • Target validation criteria:

    • Essentiality: Determine if yjjB is essential for bacterial survival or virulence

    • Conservation: Evaluate conservation across Shigella species and strains

    • Druggability: Assess whether the protein contains suitable binding pockets

    • Host homology: Confirm absence of close human homologs to minimize off-target effects

  • Therapeutic approaches:

    • Small molecule inhibitors targeting potential enzymatic functions

    • Peptide inhibitors disrupting protein-protein interactions

    • Antisense strategies to reduce yjjB expression

    • Inclusion in multicomponent vaccine formulations

  • Preliminary vaccine potential:
    While single-antigen approaches may have limited efficacy, fusion protein strategies have shown promise in Shigella vaccine development. The DB fusion (IpaB-IpaD) has demonstrated protection against multiple Shigella species including limited protection against S. dysenteriae . A similar approach incorporating yjjB could be evaluated if the protein proves immunogenic.

How can structural studies of yjjB inform drug discovery efforts?

Structural characterization of yjjB can significantly accelerate drug discovery through:

  • Structure determination methods:

    • X-ray crystallography of the purified protein

    • NMR spectroscopy for dynamic regions

    • Cryo-EM for membrane-associated contexts

    • Computational modeling based on homologous proteins

  • Structure-based drug design workflow:

    • Identification of potential binding pockets

    • Virtual screening of compound libraries

    • Fragment-based lead discovery

    • Structure-activity relationship studies of promising compounds

  • Functional site prediction:
    Computational analysis of the yjjB sequence suggests it contains multiple transmembrane domains, consistent with its highly α-helical nature . Key structural features to investigate include:

    Predicted DomainResidue PositionsPotential Function
    Transmembrane helix 16-26Membrane anchoring
    Transmembrane helix 240-60Channel/pore formation
    Transmembrane helix 389-109Substrate recognition
    C-terminal domain110-157Cytoplasmic interactions
  • Integration with experimental data:

    • Site-directed mutagenesis of predicted functional residues

    • Binding assays with potential ligands

    • Phenotypic assays of mutant variants

    • Crystallization with inhibitor compounds

What are the optimal conditions for expression and characterization of recombinant yjjB?

Optimizing expression and characterization of yjjB requires careful consideration of:

  • Expression system selection:

    • E. coli BL21(DE3) for basic expression

    • Consider co-expression with chaperones (similar to IpgC for IpaB)

    • Membrane protein expression strains (C41/C43) may improve yields

    • Inducible promoter systems (T7, araBAD) for controlled expression

  • Expression conditions optimization:

    • Temperature: 16-18°C often optimal for membrane proteins

    • Induction timing: Mid-log phase (OD600 ~0.6-0.8)

    • Inducer concentration: Titrate IPTG/arabinose for optimal expression

    • Media composition: Consider auto-induction media for higher yields

  • Solubilization and stabilization:

    • Detergent screening (mild detergents like DDM, LDAO)

    • Lipid nanodiscs for native-like environment

    • Buffer optimization with stabilizing agents (glycerol, specific salts)

  • Functional characterization assays:

    • Circular dichroism to confirm α-helical structure

    • Thermal shift assays to assess stability

    • Binding assays with potential interaction partners

    • Reconstitution in liposomes for functional studies if transport activity is suspected

How can interactions between yjjB and host cell components be investigated?

Investigating host-pathogen protein interactions requires specialized methodologies:

  • Cell infection models:

    • Intestinal epithelial cell lines (Caco-2, HT-29)

    • Macrophage cell lines for phagocytic interactions

    • Organoid models for complex tissue interactions

    • Assessment of bacterial invasion efficiency in presence/absence of yjjB

  • Protein localization during infection:

    • Immunofluorescence microscopy with anti-yjjB antibodies

    • Bacterial strains expressing fluorescently tagged yjjB

    • Fractionation of infected cells to determine localization

    • Live-cell imaging to track dynamics during infection

  • Pull-down strategies from infected cells:

    • BioID or APEX2 proximity labeling

    • Crosslinking followed by immunoprecipitation

    • Tandem affinity purification with quantitative proteomics

    • Validation of key interactions by co-immunoprecipitation

  • Functional consequences assessment:

    • Host signaling pathway activation

    • Cytoskeletal rearrangements

    • Inflammatory response modulation

    • Cell death pathway activation/inhibition

What are the major challenges in studying proteins of unknown function like yjjB?

Researchers face several significant challenges when investigating uncharacterized proteins:

  • Functional prediction limitations:

    • Bioinformatic predictions may be unreliable without close characterized homologs

    • Structural homology may exist without functional conservation

    • Expression patterns may vary across experimental conditions

    • Redundant functions may mask phenotypes in single-gene deletion studies

  • Technical challenges:

    • Generating specific antibodies against uncharacterized proteins

    • Optimizing expression and purification of potentially toxic proteins

    • Designing phenotypic screens without functional hypotheses

    • Distinguishing direct from indirect effects in complex systems

  • Experimental design considerations:

    • Need for multiple complementary approaches

    • Careful control selection for comparative studies

    • Appropriate model systems that reflect in vivo conditions

    • Validation across multiple Shigella strains and growth conditions

  • Recommended integrated approach:

    • Begin with comprehensive bioinformatic analysis

    • Follow with genetic manipulation studies

    • Proceed to protein-level characterization

    • Validate findings in infection models

How can contradictory data about yjjB function be reconciled in research?

When faced with contradictory results regarding yjjB function, researchers should:

  • Systematic analysis of experimental variables:

    • Strain differences (laboratory vs. clinical isolates)

    • Growth conditions and media composition

    • Expression levels (native vs. overexpression)

    • Genetic background of knockout strains

  • Methodological reconciliation strategies:

    • Direct comparison using standardized protocols

    • Complementation tests with varying expression levels

    • Conditional knockouts to assess context-dependent functions

    • Collaboration between laboratories for independent verification

  • Integrated data analysis:

    • Meta-analysis of published and unpublished results

    • Bayesian approaches to weigh evidence quality

    • Systems biology modeling to reconcile seeming contradictions

    • Consider multifunctional properties of the protein

  • Publication and reporting considerations:

    • Thorough methods descriptions

    • Sharing of raw data and materials

    • Explicit discussion of limitations and contradictions

    • Pre-registration of study designs when appropriate

What emerging technologies could advance understanding of yjjB function?

Several cutting-edge approaches hold promise for elucidating yjjB function:

  • CRISPR interference/activation systems:

    • CRISPRi for tunable gene repression

    • CRISPRa for controlled overexpression

    • Pooled screens to identify genetic interactions

    • Base editing for precise amino acid substitutions

  • Advanced structural biology methods:

    • Cryo-electron tomography for in situ structural studies

    • Integrative structural biology combining multiple data types

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Microcrystal electron diffraction for difficult-to-crystallize proteins

  • Single-cell technologies:

    • Single-cell RNA-seq of infected host cells

    • Single-bacterium RNA-seq during infection

    • Spatial transcriptomics of infected tissues

    • Mass cytometry for multiparameter analysis of host response

  • Computational approaches:

    • Deep learning for function prediction from sequence/structure

    • Molecular dynamics simulations of membrane integration

    • Metagenomic analysis of yjjB variants in clinical samples

    • Network analysis of protein-protein interaction data

How might yjjB research contribute to broader understanding of Shigella pathogenesis?

Investigation of yjjB can enhance our understanding of Shigella pathogenesis through:

  • Comparative analysis across Shigella species:

    • S. dysenteriae is responsible for the most severe form of shigellosis

    • S. flexneri is the most common cause in low-income countries

    • Understanding species-specific adaptation of conserved proteins

  • Insights into persistence mechanisms:

    • S. flexneri shows patterns of local persistence over decades

    • Role of conserved proteins in environmental survival

    • Contribution to colonization of specific geographic niches

  • Evolution of virulence strategies:

    • Shigella evolved from E. coli but with distinct disease phenotypes

    • Role of accessory proteins in specialized virulence mechanisms

    • Contribution to host-pathogen co-evolution

  • Antimicrobial resistance connections:

    • Multiple drug resistance is common in clinical Shigella isolates

    • Potential roles of membrane proteins in resistance phenotypes

    • Novel targets for combination therapies with existing antibiotics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.