Recombinant Shigella dysenteriae serotype 1 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
zntB; SDY_1424; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function

Mediates efflux of zinc ions.

Database Links

KEGG: sdy:SDY_1424

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ZntB in Shigella dysenteriae?

ZntB from Shigella dysenteriae serotype 1 is a 327-amino acid membrane protein (Q32GI7) that functions as a zinc transport protein . Structurally, it belongs to the family of membrane transporters that mediate zinc homeostasis in bacteria. The full-length protein contains multiple transmembrane domains that form a channel through which zinc ions can be transported .

Unlike what was initially proposed, recent research using cryo-electron microscopy of the homologous ZntB from Escherichia coli indicates that ZntB mediates zinc uptake rather than export . This transport mechanism is stimulated by a pH gradient across the membrane, suggesting a proton-driven zinc transport mechanism . The protein does not function similarly to the distantly related CorA magnesium channels as previously thought, representing a distinct transport mechanism .

What expression systems are recommended for recombinant ZntB production?

E. coli is the preferred expression system for recombinant ZntB production as demonstrated in multiple studies . When expressing ZntB, researchers should consider:

  • Using N-terminal His-tags for purification purposes, which has been shown to maintain protein functionality

  • Optimizing bacterial growth conditions, including temperature, media composition, and induction parameters to enhance soluble protein yields

  • Employing alternative plasmid expression vectors if initial yields are insufficient

  • Considering E. coli host strain selection, as different strains may affect the folding and solubility of membrane proteins like ZntB

For optimal expression, researchers should perform small-scale expression trials before scaling up production, testing variables such as induction time, inducer concentration, and post-induction growth temperature to maximize soluble protein yield.

What reconstitution protocols should be followed for purified ZntB?

For optimal reconstitution of lyophilized recombinant ZntB:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) to prevent protein aggregation and maintain stability during storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for short-term use (up to one week)

  • Store long-term aliquots at -20°C/-80°C

When using reconstituted ZntB for functional assays, it is advisable to verify protein integrity through techniques such as circular dichroism or limited proteolysis before proceeding with experimental applications.

How can researchers effectively measure zinc transport activity of ZntB?

To effectively measure zinc transport activity of ZntB, researchers can employ several complementary methodologies:

  • Liposome Reconstitution Assays:

    • Reconstitute purified ZntB into liposomes to create proteoliposomes

    • Use radioactive zinc (⁶⁵Zn) uptake assays to directly measure transport rates

    • Apply fluorescent zinc-sensitive dyes to monitor real-time zinc flux across membranes

  • pH Gradient Studies:

    • Create artificial pH gradients across proteoliposomes

    • Measure how different pH conditions affect zinc transport rates

    • This approach is particularly important as ZntB activity is stimulated by proton gradients

  • Electrophysiological Measurements:

    • Utilize patch-clamp techniques on ZntB-containing membranes

    • Measure current changes associated with zinc movement

    • Calculate transport kinetics under various voltage conditions

For accurate transport measurements, researchers should control for:

  • Buffer composition (particularly the presence of competing divalent cations)

  • Temperature (maintain at physiological conditions, typically 37°C)

  • Protein:lipid ratios in reconstituted systems

  • Zinc concentration gradients across membranes

What purification challenges are specific to ZntB and how can they be overcome?

Purification of membrane proteins like ZntB presents several challenges:

ChallengeSolution Strategy
Limited solubilityUse appropriate detergents (DDM, LDAO, or C12E8) for extraction and purification
Protein aggregationInclude stabilizing agents such as glycerol (5-50%) in purification buffers
Low expression yieldsModify bacterial growth conditions and test alternative expression vectors
Maintaining native conformationEmploy gentle purification methods and avoid harsh elution conditions
Protein heterogeneityApply additional chromatography steps (e.g., size exclusion) to achieve >90% purity

Researchers have successfully addressed these challenges by implementing multi-step purification protocols:

  • Initial immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Buffer exchange to remove imidazole

  • Additional purification through ion exchange or size exclusion chromatography

  • Quality verification through SDS-PAGE to ensure >90% purity

For maximum stability during and after purification, the addition of zinc ions at low concentrations (10-50 μM) to purification buffers may help maintain protein conformation.

What analytical techniques are most informative for characterizing ZntB-zinc interactions?

Several complementary analytical techniques provide valuable insights into ZntB-zinc interactions:

  • Isothermal Titration Calorimetry (ITC):

    • Quantifies binding thermodynamics (ΔH, ΔS, ΔG)

    • Determines binding affinity (Kd) and stoichiometry

    • Reveals whether zinc binding is enthalpy or entropy-driven

  • Structural Studies:

    • Cryo-electron microscopy has been successfully used to determine ZntB structure

    • X-ray crystallography can provide atomic-level details of zinc binding sites

    • Computational modeling based on structural data can predict conformational changes

  • Spectroscopic Methods:

    • Circular dichroism to monitor secondary structure changes upon zinc binding

    • Fluorescence spectroscopy using intrinsic tryptophan fluorescence or zinc-sensitive dyes

    • Nuclear magnetic resonance (NMR) for examining zinc-induced conformational changes

  • Mutagenesis Studies:

    • Site-directed mutagenesis of predicted zinc-binding residues

    • Functional analysis of mutants to identify essential residues for zinc transport

    • Complementation studies in zinc transport-deficient bacterial strains

When characterizing ZntB-zinc interactions, researchers should consider physiologically relevant zinc concentrations (typically in the μM range) and account for the presence of other divalent cations that might compete for binding sites.

How does the zinc transport mechanism of ZntB differ from other zinc transporters?

ZntB represents a distinct mechanism of zinc transport compared to other zinc transporter families:

  • ZntB vs. ZIP/SLC39 Transporters:

    • ZntB mediates proton-driven zinc uptake , whereas ZIP proteins generally function through facilitated diffusion or secondary active transport

    • ZntB is a homopentameric structure, while ZIP proteins typically function as monomers or dimers

    • ZntB transport is stimulated by pH gradients , a feature not consistently observed in ZIP transporters

  • ZntB vs. ZnT/SLC30 Transporters:

    • ZnTs function primarily to reduce cytosolic zinc by exporting zinc to extracellular spaces or into intracellular compartments

    • ZntB facilitates zinc uptake into the cytosol, functioning in the opposite direction

    • ZnTs typically operate as cation/proton antiporters, while ZntB appears to have a distinct proton-driven mechanism

  • Unique Structural Features:

    • Recent cryo-EM studies reveal that ZntB does not resemble the transport mechanism proposed for homologous CorA magnesium channels, despite previous assumptions

    • ZntB contains unique structural domains that differentiate it from other zinc transporters and enable its specific transport properties

Understanding these mechanistic differences is crucial for targeting ZntB in potential therapeutic applications and for predicting how changes in cellular conditions might affect zinc homeostasis in Shigella dysenteriae.

What is the significance of ZntB in Shigella dysenteriae virulence and pathogenesis?

While direct evidence specifically linking ZntB to Shigella dysenteriae virulence is limited in the provided search results, several insights can be drawn by considering:

  • Zinc Homeostasis and Bacterial Pathogenesis:

    • Zinc is a critical micronutrient in host-pathogen interactions, where hosts may either sequester zinc to limit bacterial growth or elevate zinc concentrations to toxic levels

    • Bacterial zinc transporters, including ZntB, help pathogens maintain appropriate intracellular zinc levels during infection, thereby contributing to survival in the host environment

  • Comparison with Related Virulence Factors:

    • Other membrane proteins in Shigella, such as invasion plasmid antigens (IpaB, IpaC, IpaD), are essential effectors of cell invasion processes

    • These proteins are major targets of the host immune response to shigellosis

    • ZntB may similarly play a role in bacterial adaptation within the host environment

  • Potential Vaccine Applications:

    • Recombinant Shigella proteins have shown promise as vaccine candidates

    • Membrane proteins like ZntB could potentially serve as targets for vaccine development or therapeutic antibodies if they prove critical for virulence

Further research specifically examining ZntB knockout strains and their effects on Shigella dysenteriae colonization, survival, and pathogenesis would be valuable to elucidate the precise role of this transporter in virulence.

How do pH gradients impact ZntB function and zinc homeostasis?

pH gradients significantly influence ZntB function through several mechanisms:

  • Proton-Driven Transport:

    • Research demonstrates that ZntB-mediated zinc transport is stimulated by pH gradients across the membrane

    • This suggests that proton movement may be coupled to zinc transport, similar to other secondary active transporters

  • Structural Implications:

    • pH changes likely induce conformational changes in ZntB that facilitate zinc passage through the channel

    • These structural alterations may affect zinc binding affinity and transport kinetics

    • Cryo-EM studies have begun to elucidate these structural transitions

  • Physiological Relevance:

    • During infection, Shigella encounters varying pH environments, from the acidic stomach to the near-neutral intestinal lumen

    • The pH-dependent activity of ZntB may help the bacteria adapt to these changing conditions

    • This could represent an environmental sensing mechanism that modulates zinc uptake based on local pH

  • Experimental Considerations:

    • When designing transport assays, researchers should carefully control pH on both sides of the membrane

    • Creating defined pH gradients in reconstituted systems can help quantify the relationship between proton movement and zinc transport rates

    • The direction of the pH gradient (acidic inside vs. outside) may determine the directionality of zinc transport

Understanding this pH dependence is critical for accurately characterizing ZntB function in both experimental settings and in predicting its behavior during infection.

What approaches are recommended for structural studies of ZntB?

Structural studies of membrane proteins like ZntB present unique challenges requiring specialized approaches:

  • Cryo-Electron Microscopy:

    • Successfully applied for ZntB structural determination

    • Advantages: Requires less protein, captures protein in near-native state, can resolve different conformational states

    • Protocol considerations: Optimize detergent type and concentration, screen various grid preparation methods, employ direct electron detectors

  • X-ray Crystallography:

    • Challenges: Obtaining diffraction-quality crystals of membrane proteins is difficult

    • Solutions: Use lipidic cubic phase (LCP) crystallization, test various detergents and lipids, employ fusion proteins to enhance crystallizability

    • Consider utilizing antibody fragments to stabilize specific conformations

  • Sample Preparation Enhancements:

    • Employ nanodiscs or amphipols as alternatives to detergents

    • Use directed evolution to generate stable variants amenable to structural studies

    • Consider truncation constructs that retain core functional domains if full-length protein is problematic

  • Complementary Approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamic regions

    • Solid-state NMR for specific binding site characterization

    • Molecular dynamics simulations based on partial structural data

For ZntB specifically, cryo-EM has proven successful in elucidating the structural basis of proton-driven zinc transport , making it a recommended primary approach supplemented by these complementary techniques.

What cell-based assays can accurately measure ZntB function in vivo?

Several cell-based assays can effectively measure ZntB function in living cells:

  • Zinc-Sensitive Fluorescent Reporters:

    • Transfect cells with genetically encoded zinc sensors (e.g., ZapCY2, eCALWY)

    • Monitor real-time changes in intracellular zinc levels in response to ZntB expression

    • Allows spatial resolution of zinc fluctuations in different cellular compartments

  • Growth Complementation Assays:

    • Use zinc transport-deficient bacterial strains

    • Introduce wild-type or mutant ZntB constructs

    • Measure growth restoration under zinc-limited or zinc-excess conditions

    • Quantitative readout through growth curves or competitive growth assays

  • Inducible Expression Systems:

    • Create bacterial strains with inducible ZntB expression

    • Monitor phenotypic changes upon induction in varying zinc conditions

    • Combine with reporter systems to correlate expression levels with functional outcomes

  • Radioactive Zinc Uptake:

    • Incubate cells expressing ZntB with ⁶⁵Zn

    • Measure accumulation rates compared to control cells

    • Perform under various pH conditions to verify pH-dependent transport

When designing these assays, researchers should:

  • Include appropriate controls (non-functional ZntB mutants, empty vector controls)

  • Carefully control extracellular zinc concentrations

  • Consider the effects of endogenous zinc transporters

  • Account for potential pH effects on transport activity

How can researchers differentiate between direct and indirect effects of ZntB on bacterial physiology?

Differentiating direct from indirect effects of ZntB requires systematic experimental approaches:

  • Genetic Approaches:

    • Generate precise ZntB knockout strains using CRISPR-Cas9 or similar methods

    • Create complementation strains with wild-type and mutant ZntB variants

    • Develop conditional expression systems to control ZntB levels

    • Compare phenotypes across these genetic backgrounds

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify immediate changes following ZntB activation/inactivation (direct effects)

    • Distinguish from downstream adaptive responses (indirect effects)

    • Apply network analysis to map direct vs. cascade effects

  • Temporal Studies:

    • Use time-course experiments following ZntB induction or inhibition

    • Early effects (minutes to hours) often represent direct consequences

    • Later effects (hours to days) typically indicate secondary adaptations

    • Apply mathematical modeling to deconvolute response kinetics

  • Biochemical Validation:

    • Verify direct interactions using purified components in vitro

    • Reconstitute minimal systems to test specific hypotheses

    • Apply site-directed mutagenesis to disrupt specific functions while preserving others

  • Comparative Analysis Across Species:

    • Examine ZntB function in related Enterobacteriaceae

    • Identify conserved vs. species-specific effects

    • This approach can highlight core direct functions versus contextual indirect effects

By systematically applying these approaches, researchers can build a comprehensive model distinguishing primary ZntB functions from secondary physiological adaptations.

What is the potential of ZntB as a target for anti-Shigella therapeutics?

ZntB presents several promising attributes as a potential therapeutic target:

  • Essential Function Considerations:

    • If ZntB plays a critical role in zinc homeostasis during infection, inhibiting it could impair bacterial survival

    • The pH-dependent function of ZntB suggests targeting could be environment-specific, potentially limiting off-target effects

  • Structural Uniqueness:

    • The distinct mechanism of ZntB compared to human zinc transporters could allow for selective targeting

    • Recent structural studies provide templates for rational drug design approaches

    • The outer membrane location makes it potentially accessible to antibodies or other biologics

  • Combined Vaccine-Therapeutic Approach:

    • Research on recombinant Shigella proteins has shown immunomodulatory potential

    • Anti-ZntB antibodies could potentially neutralize protein function while marking bacteria for immune clearance

    • This approach could complement traditional antibiotic strategies

  • Considerations and Limitations:

    • Redundancy in zinc transport systems may limit efficacy of ZntB-specific inhibitors

    • The conservation of ZntB across bacterial species requires careful specificity testing

    • The role of ZntB in pathogenesis needs further characterization to validate it as a therapeutic target

Development of high-throughput screening assays for ZntB inhibitors, combined with in vivo validation in infection models, would be valuable next steps in exploring this therapeutic direction.

How can advanced imaging techniques enhance our understanding of ZntB localization and dynamics?

Advanced imaging techniques offer powerful approaches to study ZntB localization and dynamics:

  • Super-Resolution Microscopy:

    • Techniques such as STORM, PALM, or STED microscopy can resolve ZntB distribution beyond the diffraction limit

    • Applications: Map ZntB clustering during infection, visualize co-localization with other virulence factors

    • Sample preparation: Use fluorescently-tagged ZntB constructs or specific antibodies for immunolabeling

  • Single-Molecule Tracking:

    • Label ZntB with quantum dots or photoactivatable fluorophores

    • Track individual ZntB molecules to reveal diffusion rates and confinement zones

    • Correlate mobility changes with zinc availability or pH fluctuations

  • FRET-Based Sensors:

    • Design ZntB constructs with FRET pairs to detect conformational changes

    • Monitor real-time structural alterations during transport cycles

    • Measure the effects of potential inhibitors on protein dynamics

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Visualize ZntB in relation to membrane microdomains and other cellular structures

    • Particular value for studying ZntB during host-pathogen interactions

  • Live Cell Imaging During Infection:

    • Develop infection models compatible with advanced microscopy

    • Track ZntB redistribution during different stages of infection

    • Correlate ZntB dynamics with bacterial invasion and survival processes

These imaging approaches, when combined with functional assays, can provide unprecedented insights into how ZntB localization and dynamics contribute to zinc homeostasis and bacterial pathogenesis.

What comparative genomics approaches can reveal evolutionary insights about ZntB in enteric pathogens?

Comparative genomics offers valuable perspectives on ZntB evolution and specialization:

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of ZntB sequences across bacterial species

    • Identify conserved domains versus variable regions

    • Compare evolutionary rates between pathogenic and non-pathogenic strains

    • Methodology: Maximum likelihood or Bayesian inference approaches with appropriate evolutionary models

  • Synteny Analysis:

    • Examine the genomic context surrounding ZntB genes

    • Identify co-evolved gene clusters that may function together

    • Map horizontal gene transfer events that might have influenced ZntB distribution

    • Tools: SyntTax, Mugsy, or custom synteny visualization approaches

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Correlate selection hotspots with functional domains or host interaction regions

    • Compare selection patterns between different bacterial lineages

    • Software: PAML, HyPhy, or DataMonkey web server

  • Structural Variation Analysis:

    • Map sequence variations onto 3D structural models

    • Identify species-specific features that might confer functional differences

    • Predict the impact of natural variations on transport activity

    • Integration: Combine sequence analysis with available structural data

  • Pan-genome Approaches:

    • Determine if ZntB is part of the core or accessory genome in Enterobacteriaceae

    • Identify lineage-specific variations that might reflect adaptation to specific niches

    • Correlate ZntB variants with pathogenicity islands or virulence traits

These approaches can reveal how ZntB has evolved in different enteric pathogens, potentially identifying adaptations that enhance bacterial fitness during infection or in specific environmental niches.

What are the most critical unanswered questions regarding ZntB function in Shigella dysenteriae?

Despite recent advances, several critical questions about ZntB in Shigella dysenteriae remain unanswered:

  • Physiological Role:

    • What is the precise contribution of ZntB to zinc homeostasis in S. dysenteriae compared to other zinc transporters?

    • How essential is ZntB for survival under different environmental conditions, particularly during infection?

  • Regulatory Mechanisms:

    • How is ZntB expression regulated in response to varying zinc levels?

    • What transcription factors control ZntB expression, and how do they integrate with other stress responses?

  • Host-Pathogen Interactions:

    • Does ZntB activity change during different stages of infection?

    • How does ZntB help S. dysenteriae counter host nutritional immunity strategies?

    • Is ZntB recognized by the host immune system, and does this contribute to pathogen clearance?

  • Transport Mechanism:

    • What is the stoichiometry of proton:zinc transport?

    • Which specific amino acid residues are essential for zinc coordination and transport?

    • How do zinc and proton binding induce conformational changes that facilitate transport?

  • Therapeutic Potential:

    • Can ZntB be effectively targeted for antimicrobial development?

    • Would ZntB inhibition sufficiently impair bacterial fitness to clear infection?

    • Could ZntB serve as an effective component in vaccine formulations?

Addressing these questions will require integrating structural biology, molecular genetics, biochemistry, and infection models to build a comprehensive understanding of ZntB's role in S. dysenteriae pathophysiology.

What interdisciplinary approaches might accelerate research on bacterial zinc transporters like ZntB?

Accelerating research on bacterial zinc transporters like ZntB will benefit from interdisciplinary approaches that integrate diverse expertise:

  • Structural Biology + Computational Biophysics:

    • Apply molecular dynamics simulations to cryo-EM structures

    • Model zinc and proton transport pathways through the protein

    • Predict conformational changes during the transport cycle

    • This integration would provide mechanistic insights difficult to obtain through either approach alone

  • Microbiology + Systems Biology:

    • Apply genome-scale metabolic modeling to predict the effects of ZntB perturbation

    • Integrate transcriptomic and proteomic data to map zinc-responsive networks

    • Develop predictive models of bacterial adaptation to zinc stress

    • This would contextualize ZntB function within broader cellular processes

  • Biochemistry + Synthetic Biology:

    • Engineer zinc-responsive circuits incorporating ZntB components

    • Create artificial zinc sensing and transport systems

    • Develop high-throughput screening platforms for ZntB modulators

    • This could yield both basic insights and applied technologies

  • Immunology + Vaccinology:

    • Explore ZntB as a component in multicomponent vaccines

    • Study host immune recognition of bacterial zinc transporters

    • Develop strategies to target zinc acquisition during infection

    • This integrated approach could advance both fundamental understanding and therapeutic applications

  • Clinical Microbiology + Epidemiology:

    • Correlate ZntB variants with virulence or antibiotic resistance profiles

    • Examine ZntB expression in clinical isolates from different infection sites

    • Track zinc transporter evolution in response to antimicrobial pressure

    • This would connect molecular mechanisms to clinical outcomes

These interdisciplinary approaches, supported by shared resources and collaborative networks, would accelerate progress in understanding bacterial zinc transporters while potentially yielding novel therapeutic strategies.

How might findings from ZntB research translate to applications beyond basic science?

Research on ZntB has potential applications extending beyond basic science:

  • Antimicrobial Development:

    • Design of ZntB inhibitors as novel antibacterials

    • Development of combination therapies targeting zinc homeostasis

    • Creation of zinc-sequestering strategies to complement conventional antibiotics

    • These approaches could help address the growing challenge of antibiotic resistance

  • Vaccine Technology:

    • Incorporation of ZntB epitopes into subunit or recombinant vaccines

    • Use of ZntB as a carrier protein for conjugate vaccines

    • Development of outer membrane vesicle vaccines containing ZntB

    • Such approaches could yield vaccines against shigellosis and potentially other enteric infections

  • Diagnostic Applications:

    • Development of rapid tests detecting ZntB expression as a marker of active infection

    • Creation of biosensors using ZntB components to detect zinc in environmental or clinical samples

    • Use of anti-ZntB antibodies in diagnostic assays for Shigella detection

  • Biotechnology Tools:

    • Adaptation of ZntB for controlled zinc delivery in biotechnology applications

    • Development of zinc-responsive gene expression systems based on ZntB regulatory elements

    • Creation of zinc biosensors using engineered ZntB proteins

    • These tools could have applications in synthetic biology and bioengineering

  • Environmental Monitoring:

    • Use of ZntB-based biosensors to detect zinc contamination in water supplies

    • Development of bacterial bioreporters incorporating ZntB for environmental monitoring

    • Creation of bioremediation systems using optimized ZntB variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.