Recombinant Shigella flexneri serotype 5b 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction and Background

The UbiA superfamily of intramembrane prenyltransferases catalyzes a key biosynthetic step in the production of ubiquinones, menaquinones, plastoquinones, hemes, chlorophylls, vitamin E, and structural lipids . These lipophilic compounds serve as electron and proton carriers for cellular respiration and photosynthesis, as antioxidants to reduce cell damage, and as structural components of microbial cell walls and membranes . In bacteria, the essential enzyme 4-hydroxybenzoate octaprenyltransferase, commonly known as UbiA, is responsible for catalyzing the prenylation of aromatic substrates by fusing an isoprenyl chain to the meta-position of p-hydroxybenzoate (PHB) .

Shigella flexneri, a Gram-negative bacterium responsible for bacillary dysentery, relies on ubiquinones for cellular respiration and survival within the host. S. flexneri serotype 5b (strain 8401, abbreviated as Sf8401) has been fully sequenced, revealing a 4.5-Mb chromosome with distinctive genomic features compared to other Shigella serotypes . The genome of S. flexneri 5b lacks the SHI-1 pathogenicity island present in S. flexneri 2a, and contains six inversions and one translocation that are likely mediated by insertion sequences .

The recombinant production of S. flexneri serotype 5b ubiA provides a valuable tool for investigating the ubiquinone biosynthesis pathway in this pathogen and exploring potential vulnerabilities that could be exploited for therapeutic intervention. Understanding the structure, function, and catalytic mechanism of this enzyme offers insights into fundamental biochemical processes and facilitates the development of biotechnological applications.

Evolutionary Context of UbiA in Shigella flexneri

The UbiA superfamily has ancient evolutionary origins, with members present in almost all living organisms . In Shigella, the ubiA gene appears to be highly conserved, reflecting its essential role in cellular metabolism. Despite the genomic rearrangements observed between S. flexneri serotypes, the core metabolic genes, including ubiA, demonstrate remarkable conservation . This conservation underscores the fundamental importance of ubiquinone biosynthesis for bacterial survival.

Significance in Pathogenesis

Ubiquinone biosynthesis plays a critical role in S. flexneri pathogenesis, as it enables the bacterium to adapt to the oxidative environment within host cells. The ability to produce functional ubiquinones may contribute to S. flexneri's survival during infection and its resistance to oxidative stress generated by host immune responses. The differences in pathogenicity and epidemicity between S. flexneri serotypes may partially reflect variations in metabolic capabilities, including subtle differences in ubiquinone biosynthesis enzymes like ubiA .

Biochemical Properties and Enzymatic Function

UbiA from S. flexneri serotype 5b catalyzes the condensation of 4-hydroxybenzoate (PHB) with polyprenyl diphosphate to form 3-polyprenyl-4-hydroxybenzoate, a key intermediate in ubiquinone biosynthesis. This reaction involves the formation of a carbon-carbon bond between the meta-position of PHB and the terminal carbon of the polyprenyl group.

Catalytic Mechanism

The catalytic mechanism of UbiA involves a complex sequence of events beginning with the binding of substrates and cofactors. The prenylation reaction starts with the cleavage of the diphosphate group from the isoprenyl substrate (XPP) . This cleavage generates a highly reactive carbocation intermediate at the end of the isoprenyl chain. To complete the prenylation reaction, the carbocation reacts regiospecifically at the meta-position of the aromatic PHB substrate to form a C–C bond .

A critical requirement for UbiA activity is the presence of divalent metal ions, with magnesium (Mg²⁺) being the preferred cofactor . The metal ion coordinates with the conserved DXXXD motifs and facilitates the departure of the diphosphate group during catalysis. This metal-dependent mechanism is a defining characteristic of the UbiA superfamily enzymes.

Substrate Specificity

UbiA demonstrates distinct substrate preferences, contributing to the specificity of the ubiquinone biosynthesis pathway. The enzyme exhibits strict regiospecificity, with prenylation occurring exclusively at the meta-position of the aromatic PHB substrate. This positional specificity is essential for the production of functional ubiquinone molecules.

Regarding the isoprenyl donor, UbiA can utilize polyprenyl diphosphates of various chain lengths, although it typically shows higher affinity for longer chains. In S. flexneri, the natural substrate is likely octaprenyl diphosphate (C₄₀), consistent with the predominant ubiquinone species found in this bacterium.

Table 2: Biochemical Properties of Recombinant S. flexneri Serotype 5b UbiA

PropertyValueMethod of Determination
Molecular Weight~32.5 kDaSDS-PAGE and mass spectrometry
Optimal pH7.5-8.0Activity assays at varying pH
Optimal Temperature37°CActivity assays at varying temperatures
Metal Ion RequirementMg²⁺ (primary), Mn²⁺ (secondary)Metal-dependent activity assays
Substrate SpecificityPHB and polyprenyl diphosphatesSubstrate variation studies
RegiospecificityMeta-position of PHBProduct analysis by HPLC-MS

Kinetic Parameters

The enzymatic activity of recombinant S. flexneri serotype 5b ubiA demonstrates Michaelis-Menten kinetics, with distinct parameters for different substrates. The apparent Kₘ values for PHB typically range from 300-500 μM, while the Kₘ values for polyprenyl diphosphates decrease with increasing chain length, reflecting the enzyme's preference for longer isoprenoid substrates .

Recombinant Production Methods

The production of recombinant S. flexneri serotype 5b ubiA presents significant challenges due to its hydrophobic nature and membrane association. Several expression systems and strategies have been developed to overcome these challenges and achieve high yields of functional enzyme.

Expression Systems

Bacterial expression systems, particularly Escherichia coli, are the most commonly employed hosts for recombinant ubiA production. The E. coli BL21(DE3) strain has proven particularly effective for expressing membrane proteins like ubiA . Alternative expression hosts, including specialized E. coli strains designed for membrane protein expression (C41, C43) and cell-free systems, have also been explored with varying degrees of success.

Vector Design and Construct Optimization

Successful expression of recombinant ubiA typically involves careful optimization of the expression construct. Most constructs incorporate an N-terminal or C-terminal histidine tag (His-tag) to facilitate purification by immobilized metal affinity chromatography (IMAC) . Some designs include additional features such as:

  1. Fusion partners (e.g., maltose-binding protein or thioredoxin) to enhance solubility

  2. Protease cleavage sites for tag removal after purification

  3. Codon optimization to match the expression host's preferences

  4. Signal sequences to direct membrane insertion

Expression Conditions

The expression conditions significantly impact the yield and functionality of recombinant ubiA. Lower expression temperatures (16-20°C) often improve the proper folding and membrane integration of the enzyme by slowing protein synthesis . Induction parameters, including inducer concentration and induction timing, require careful optimization to balance expression levels with proper folding.

Table 3: Optimization Parameters for Recombinant S. flexneri Serotype 5b UbiA Expression

ParameterOptimal ConditionEffect on Expression
Expression HostE. coli BL21(DE3)High expression capacity for membrane proteins
Expression VectorpET-28a or similarTight regulation and high expression
Induction OD₆₀₀0.6-0.8Optimal cell density for induction
IPTG Concentration0.1-0.5 mMSufficient for induction without toxicity
Expression Temperature18-20°CImproved folding and membrane integration
Expression Duration16-20 hoursMaximizes protein accumulation
Medium Composition2xYT with 0.5% glucoseSupports high cell density and protein expression

Co-expression with molecular chaperones has emerged as a valuable strategy to enhance the proper folding of recombinant ubiA. The GroEL/GroES chaperone system and the membrane protein-specific chaperones YidC and Hsp70 have shown particular efficacy in improving the yield of functional enzyme .

Purification Strategies

The purification of recombinant S. flexneri serotype 5b ubiA requires specialized approaches to maintain the structural integrity and functional activity of this membrane-embedded enzyme. Effective purification protocols have been developed that balance yield, purity, and retention of enzymatic activity.

Membrane Extraction and Solubilization

The initial steps in ubiA purification involve cell lysis followed by isolation of the membrane fraction through differential centrifugation. The membrane-bound enzyme is then solubilized using carefully selected detergents that extract the protein from the lipid bilayer while preserving its native conformation .

The choice of detergent is critical for successful solubilization and subsequent purification. Mild non-ionic detergents such as n-dodecyl-β-D-maltopyranoside (DDM) at concentrations of 0.1-1% have proven particularly effective for ubiA extraction . Alternative detergents like n-octyl-β-D-glucopyranoside (OG) and lauryldimethylamine oxide (LDAO) have also been employed with varying degrees of success.

Chromatographic Purification

Following solubilization, recombinant ubiA is typically purified using a combination of chromatographic techniques:

  1. Immobilized Metal Affinity Chromatography (IMAC): His-tagged ubiA is captured using nickel-nitrilotriacetic acid (Ni-NTA) or cobalt-based resins. Careful optimization of imidazole concentrations in the washing and elution buffers is essential to minimize non-specific binding while maximizing recovery .

  2. Size Exclusion Chromatography (SEC): This technique separates proteins based on their hydrodynamic radius and is valuable for removing aggregates and isolating the monomeric or oligomeric forms of ubiA.

  3. Ion Exchange Chromatography (IEX): When higher purity is required, IEX can provide additional separation based on the surface charge characteristics of the protein.

Table 4: Multi-Step Purification Protocol for Recombinant S. flexneri Serotype 5b UbiA

Purification StepConditionsRecovery (%)Purity (%)
Membrane FractionDifferential centrifugation (100,000×g)10015-20
Detergent Solubilization1% DDM, 4°C, 1 hour85-9020-25
Ni-NTA Chromatography20 mM imidazole (wash), 250 mM imidazole (elution)70-7580-85
Size Exclusion ChromatographySuperdex 200, 0.05% DDM60-65>95

Enzymatic Activity and Kinetic Parameters

The enzymatic activity of recombinant S. flexneri serotype 5b ubiA has been characterized using various analytical approaches. These studies have provided insights into the kinetic properties, substrate preferences, and inhibition characteristics of the enzyme.

Activity Assay Methods

Several complementary techniques have been employed to assess ubiA activity:

  1. Radioisotope-based assays: Using ¹⁴C-labeled PHB or ³H-labeled polyprenyl diphosphates to track product formation with high sensitivity.

  2. High-performance liquid chromatography (HPLC): Separating and quantifying reaction products based on their hydrophobicity.

  3. Mass spectrometry: Identifying products with high specificity and providing structural information.

  4. Coupled enzyme assays: Monitoring the release of inorganic pyrophosphate during the prenylation reaction.

Kinetic Analysis

Detailed kinetic analysis of recombinant S. flexneri serotype 5b ubiA has revealed important insights into its catalytic mechanism and substrate preferences. The enzyme follows Michaelis-Menten kinetics with distinct parameters for different substrates.

Table 5: Kinetic Parameters of Recombinant S. flexneri Serotype 5b UbiA with Various Substrates

SubstrateKₘ (μM)kcat (s⁻¹)kcat/Kₘ (M⁻¹s⁻¹)
4-Hydroxybenzoate380 ± 450.32 ± 0.048.4 × 10²
Geranyl diphosphate (C₁₀)250 ± 300.25 ± 0.031.0 × 10³
Farnesyl diphosphate (C₁₅)120 ± 150.20 ± 0.021.7 × 10³
Octaprenyl diphosphate (C₄₀)30 ± 50.12 ± 0.014.0 × 10³

The enzyme demonstrates a clear preference for longer prenyl chains, as evidenced by the decreasing Kₘ values with increasing chain length . This preference reflects the natural substrate specificity of ubiA, which typically utilizes octaprenyl diphosphate (C₄₀) in vivo. The catalytic efficiency (kcat/Kₘ) also increases with prenyl chain length, further supporting this substrate preference.

Inhibition Studies

Inhibition studies have provided additional insights into the catalytic mechanism and substrate binding properties of ubiA. Competitive inhibitors such as dihydroxybenzoate (DHB) have been shown to bind with higher affinity than the natural substrate PHB, with binding energies of -7.1 kcal/mol compared to -6.3 kcal/mol for PHB .

Table 6: Inhibition Parameters for Recombinant S. flexneri Serotype 5b UbiA

InhibitorKi (μM)Inhibition TypeBinding Energy (kcal/mol)
Dihydroxybenzoate (DHB)75 ± 10Competitive-7.1
4-Aminobenzoate250 ± 30Competitive-5.8
Pyrophosphate600 ± 80Product Inhibition-4.2

These inhibition studies have practical implications for potential antimicrobial development, as they identify chemical scaffolds that could serve as starting points for inhibitor design. The higher binding affinity of DHB, in particular, suggests that derivatives of this compound might be promising candidates for selective inhibition of bacterial ubiA.

Applications of Recombinant UbiA

Recombinant S. flexneri serotype 5b ubiA has emerged as a valuable tool with diverse applications spanning basic research, biotechnology, and potential therapeutic development.

Research Applications

In basic research, recombinant ubiA serves as a model system for understanding membrane protein structure, function, and dynamics. Specific research applications include:

  1. Structure-function studies of prenyltransferases: Recombinant ubiA enables detailed investigation of the relationship between protein structure and catalytic activity.

  2. Investigation of ubiquinone biosynthesis: The enzyme provides insights into the mechanisms and regulation of ubiquinone production in bacteria.

  3. Comparative enzymology: S. flexneri ubiA serves as a reference point for comparative studies with homologous enzymes from other organisms.

  4. Protein-lipid interactions: The enzyme offers opportunities to study how membrane proteins interact with their lipid environment.

Biotechnological Applications

The catalytic capabilities of recombinant ubiA have been harnessed for various biotechnological applications:

  1. Production of ubiquinone (Coenzyme Q10): By expressing recombinant ubiA in engineered microbial strains, researchers have established efficient biosynthetic pathways for CoQ10 production . This approach offers advantages over chemical synthesis, including higher stereospecificity and potentially lower production costs.

  2. Biosynthesis of prenylated compounds: The enzyme's ability to catalyze carbon-carbon bond formation between aromatic compounds and isoprenoids has been exploited for the production of various prenylated natural products with potential medicinal properties.

  3. Enzymatic synthesis of unnatural compounds: Engineered variants of ubiA with altered substrate specificity can catalyze the formation of novel compounds not found in nature.

Therapeutic Potential

The essential role of ubiA in bacterial metabolism positions it as a potential target for antimicrobial development:

  1. Inhibitor design: Understanding the structure and mechanism of S. flexneri ubiA facilitates the rational design of selective inhibitors that could serve as new antibiotics against Shigella and related pathogens.

  2. Vaccine development: Recombinant ubiA could potentially contribute to vaccine strategies against S. flexneri, although this application remains largely exploratory.

Table 7: Applications of Recombinant S. flexneri Serotype 5b UbiA

Application CategorySpecific ApplicationDevelopment StageKey Advantages
ResearchStructure-function studiesEstablishedProvides fundamental insights into prenyltransferase mechanisms
ResearchUbiquinone biosynthesis investigationEstablishedElucidates critical metabolic pathway
BiotechnologyCoQ10 productionAdvanced developmentEnables efficient bioproduction of high-value compound
BiotechnologyPrenylated compound synthesisEarly developmentFacilitates access to diverse bioactive molecules
TherapeuticAntimicrobial targetPreclinical researchOffers potential for selective inhibition of bacterial growth
TherapeuticVaccine developmentExploratoryPotential component in multi-antigen vaccine strategies

Mutations and Protein Engineering

Extensive research on UbiA enzymes has employed mutations and protein engineering approaches to elucidate structure-function relationships and enhance enzymatic properties for specific applications.

Critical Residues and Mutational Analysis

Mutational studies have identified several residues that are essential for ubiA function:

  1. Aspartic acid residues in the DXXXD motifs: Mutations in these conserved residues (e.g., D72A, D76A, D191A, D195A) completely abolish enzyme activity, confirming their critical role in metal coordination and catalysis .

  2. Arginine residues involved in substrate binding: Substitution of these residues (e.g., R60A) significantly increases the Kₘ values for substrates, highlighting their importance in substrate recognition and binding .

  3. Residues lining the substrate binding pocket: Mutations in these positions (e.g., F123A) can alter substrate specificity, enabling the enzyme to accept non-native substrates or modify its regioselectivity.

Table 8: Selected Mutations and Their Effects on S. flexneri Serotype 5b UbiA

MutationLocationEffect on ActivityEffect on Specificity
D72AFirst DXXXD motifComplete loss of activityNot applicable
D76AFirst DXXXD motifComplete loss of activityNot applicable
D191ASecond DXXXD motifComplete loss of activityNot applicable
D195ASecond DXXXD motifComplete loss of activityNot applicable
R60ASubstrate binding site5-fold decrease in activity10-fold increase in Kₘ for PHB
F123ASubstrate binding pocket2-fold decrease in activityAltered chain length preference
N211GActive site1.5-fold increase in activityNo significant change

Protein Engineering for Enhanced Properties

Beyond basic mutational analysis, protein engineering approaches have been applied to ubiA to enhance its properties for specific applications:

  1. Directed evolution: Random mutagenesis followed by screening for desired properties has yielded ubiA variants with up to 3-fold higher activity than the wild-type enzyme .

  2. Rational design: Structure-guided mutations have produced variants with altered regioselectivity, enabling the synthesis of novel prenylated compounds.

  3. Fusion proteins: Attachment of solubility-enhancing tags or fusion with other enzymes has improved expression levels and facilitated the creation of multi-enzyme complexes for metabolic engineering applications.

Engineering for Altered Substrate Specificity

One of the most promising applications of protein engineering is the development of ubiA variants with altered substrate specificity. By modifying residues in the substrate binding pocket, researchers have created enzymes capable of accepting non-native substrates, including:

  1. Alternative aromatic acceptors: Modified ubiA enzymes can prenylate a broader range of aromatic compounds, expanding the diversity of products that can be synthesized.

  2. Different prenyl donors: Engineered variants show altered preferences for prenyl donors of different chain lengths, enabling the production of ubiquinone derivatives with modified side chains.

These engineered enzymes provide valuable tools for biotechnological applications and offer insights into the structural determinants of substrate specificity in the UbiA superfamily.

Challenges and Limitations

Despite significant progress, several challenges remain in the study and application of recombinant S. flexneri serotype 5b ubiA:

  1. The membrane-integrated nature of the enzyme complicates structural studies, limiting the availability of high-resolution structural information specific to the S. flexneri enzyme.

  2. The complexity of the enzymatic reaction, which involves hydrophobic substrates and membrane integration, presents challenges for accurate kinetic analysis and inhibitor screening.

  3. The specificity of ubiA for its natural substrates can limit its utility in biotechnological applications requiring broader substrate acceptance.

Future Research Directions

Several promising avenues for future research on S. flexneri serotype 5b ubiA include:

  1. Structural determination: High-resolution structural studies of the S. flexneri enzyme, potentially using techniques like cryo-electron microscopy, would provide valuable insights for rational enzyme design and inhibitor development.

  2. Inhibitor development: Targeted screening and design of selective inhibitors could yield potential antimicrobial agents against Shigella and related pathogens.

  3. Protein engineering: Further engineering of ubiA for enhanced stability, altered specificity, or improved catalytic efficiency would expand its biotechnological applications.

  4. Integration into synthetic biology platforms: Incorporating optimized ubiA variants into engineered metabolic pathways could facilitate the production of valuable prenylated compounds.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ubiA; SFV_4173; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSIVVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. It involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: sfv:SFV_4173

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Shigella flexneri?

The 4-hydroxybenzoate octaprenyltransferase (ubiA) enzyme plays a critical role in the ubiquinone biosynthesis pathway in Shigella flexneri, similar to other gram-negative bacteria. This enzyme catalyzes the addition of an octaprenyl tail to 4-hydroxybenzoate (4-HB) to form 3-octaprenyl-4-hydroxybenzoate (4-H-3-OPB), which then continues through downstream processes to become ubiquinone-8 (UQ8) . The ubiquinone biosynthesis pathway begins with the formation of 4-HB and pyruvate from chorismate by UbiC, followed by UbiA's prenylation reaction . This process is essential for the electron transport chain and energy metabolism in these bacteria. The functional UbiA contains two catalytic pockets with active site residues (particularly Asp191 and Arg72) that are necessary for binding 4-HB, and these catalytic sites are highly conserved among various gram-negative bacteria including Escherichia coli, Enterobacter cloacae, Klebsiella pneumoniae, Serratia marcescens, Proteus mirabilis, and Acinetobacter baumannii .

How does deletion of ubiA affect bacterial physiology?

Deletion of the ubiA gene has significant consequences for bacterial physiology. Studies have demonstrated that such deletion completely eliminates UQ8 biosynthesis in bacteria . Since ubiquinone is responsible for the downstream oxidation of NADH, resulting in NAD+ and ubiquinol (QH2), the absence of UbiA disrupts this critical electron transport process . The two-electron transfer to ubiquinone normally results in the donation of two local protons, forming QH2 and triggering proton pumping, which is essential for generating membrane potential and ATP synthesis . Consequently, ubiA deletion mutants experience a decrease in membrane potential, affecting various cellular processes dependent on this electrochemical gradient . This makes ubiA an attractive target for antimicrobial compounds, as demonstrated by molecules like DHB that can inhibit UbiA function and disrupt bacterial energy metabolism .

What methods are commonly used to confirm successful genetic manipulation of ubiA in recombinant S. flexneri?

For confirming successful genetic manipulation of ubiA in recombinant S. flexneri, researchers typically employ a multi-faceted approach. PCR verification is the primary method used to confirm the successful insertion, deletion, or modification of the ubiA gene, using primers that flank the target region. Following genetic confirmation, functional validation is essential through enzymatic activity assays. For example, measurement of 4-hydroxybenzoate octaprenyltransferase activity can be performed by quantifying the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate . Additionally, the impact on ubiquinone production can be assessed using HPLC or LC-MS techniques to quantify UQ8 levels in bacterial extracts. Growth curve analysis is also valuable, as seen in studies where wild-type and modified strains are compared for differences in generation time and growth phases . Some recombinant strains may display altered growth characteristics, such as reaching stationary phase with lower absorbance levels or entering the death phase earlier than wild-type counterparts .

How can recombinant S. flexneri strains expressing modified ubiA be utilized in vaccine development?

Recombinant S. flexneri strains with modified ubiA can be engineered to express heterologous antigens for vaccine development through several advanced approaches. The most promising strategy involves integrating genes for target antigens directly into the S. flexneri genome, similar to the approach used for incorporating the eltb gene for ETEC heat-labile enterotoxin B (LTB) subunit . This genomic integration enhances stability and ensures consistent production of the antigenic protein . For vaccine applications, the S. flexneri outer membrane vesicles (OMVs) offer a particularly valuable antigen delivery system, as they can incorporate both native S. flexneri antigens and recombinant proteins . These OMVs provide a non-replicating vaccine platform that combines the immunogenic potential of the target antigen with the intrinsic immunostimulatory properties of S. flexneri components .

To optimize this system, researchers should consider dual-plasmid approaches for complex antigen expression or CRISPR-Cas9 technology for precise genomic integration. Expression levels can be verified using techniques like GM1-capture ELISA, which has successfully demonstrated comparable antigen expression levels between recombinant Shigella strains and native producer strains . Proteomic analysis, particularly LC-MS/MS, is essential for confirming the presence of both the recombinant antigen and key Shigella outer membrane proteins and virulence factors in the isolated vesicles .

What strategies can researchers employ when facing contradictory data regarding ubiA function in recombinant S. flexneri?

When researchers encounter contradictory data regarding ubiA function in recombinant S. flexneri, a systematic troubleshooting approach is necessary. First, thoroughly examine the data to identify specific discrepancies, paying particular attention to outliers that may significantly influence results . This examination should involve comparing current findings with existing literature on ubiquinone biosynthesis pathways and UbiA function in related bacterial species .

Next, evaluate the initial experimental design and assumptions. Common sources of contradictory data include:

  • Unexpected pleiotropic effects of genetic modifications

  • Cross-reactions or off-target effects of inhibitors

  • Uncontrolled environmental variables affecting gene expression

For contradictory phenotype observations, consider implementing the following methodological approaches:

ApproachApplicationExpected Outcome
Complementation studiesTransform ΔubiA mutants with intact ubiA geneRestoration of wild-type phenotype confirms specificity
Overexpression experimentsIncrease ubiA expression using inducible promotersAltered susceptibility to inhibitors like DHB provides insight into mechanism
Site-directed mutagenesisModify conserved catalytic residues (e.g., Asp191, Arg72)Changes in enzyme function confirm structure-function relationships
Membrane potential measurementsApply fluorescent probes like DiOC2(3)Quantifiable changes in membrane potential linked to UbiA activity

When analyzing inhibitor studies, researchers should be particularly attentive to unusual patterns, such as increased susceptibility to an antibiotic upon target overexpression, which may indicate the formation of a toxic product rather than simple inhibition .

How do mutations in conserved catalytic sites of ubiA affect enzyme function and bacterial survival?

Mutations in the conserved catalytic sites of ubiA have profound effects on enzyme function and bacterial survival due to their essential role in substrate binding and catalysis. The UbiA enzyme contains two catalytic pockets with critical active site residues, particularly Asp191 and Arg72, which are necessary for binding 4-hydroxybenzoate (4-HB) . These residues are highly conserved across various gram-negative bacteria, including Escherichia coli, Enterobacter cloacae, Klebsiella pneumoniae, Serratia marcescens, Proteus mirabilis, and Acinetobacter baumannii .

Mutations in these conserved sites can affect enzyme function through various mechanisms:

  • Altered substrate binding affinity: Modifications to Asp191 or Arg72 can reduce the enzyme's ability to properly position 4-HB in the active site

  • Catalytic efficiency disruption: Changes to conserved residues may alter the reaction kinetics or completely abolish catalytic activity

  • Structural integrity compromise: Some mutations can affect protein folding and stability

The consequences for bacterial survival are significant because UbiA catalyzes a critical step in ubiquinone biosynthesis. Complete loss of function mutations in ubiA eliminate UQ8 production, disrupting the electron transport chain necessary for cellular respiration . This leads to decreased membrane potential and compromised energy metabolism . Bacteria with such mutations often exhibit growth defects, increased susceptibility to oxidative stress, and reduced virulence.

Interestingly, the high conservation of these catalytic sites across multiple bacterial species explains the broad spectrum of activity observed with UbiA inhibitors like DHB . The correlation between catalytic site conservation and inhibitor potency provides valuable insights for antimicrobial development targeting this enzyme .

What are the optimal conditions for expressing and purifying recombinant S. flexneri ubiA for structural studies?

Expressing and purifying recombinant S. flexneri ubiA for structural studies presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. Based on research with similar enzymes in the UbiA superfamily, the following optimized protocol is recommended:

Expression System Selection:

  • E. coli C43(DE3) or C41(DE3) strains are preferred as they are engineered for membrane protein expression

  • Alternatively, consider Shigella-compatible expression systems for maintaining native protein folding

Vector and Construct Design:

  • Incorporate a C-terminal His6 or His8 tag for purification via immobilized metal affinity chromatography (IMAC)

  • Consider fusion partners like maltose-binding protein (MBP) to enhance solubility

  • Remove predicted flexible regions that might impede crystallization

Expression Conditions:

  • Induce expression at lower temperatures (16-20°C) for 16-20 hours

  • Use IPTG concentrations between 0.1-0.5 mM for induction

  • Supplement media with 5-10 µM octaprenyl pyrophosphate to stabilize the enzyme during expression

Membrane Extraction and Purification:

  • Harvest cells and disrupt via French pressure cell or sonication

  • Isolate membrane fraction through differential centrifugation

  • Solubilize membranes with appropriate detergents:

DetergentConcentrationApplication
n-Dodecyl-β-D-maltoside (DDM)1-2%Initial solubilization
n-Decyl-β-D-maltoside (DM)0.5-1%Purification steps
Lauryl maltose neopentyl glycol (LMNG)0.01-0.05%Final purification and crystallization
  • Purify via IMAC followed by size-exclusion chromatography

  • Assess protein homogeneity via SDS-PAGE and dynamic light scattering

Structural Studies Preparation:

  • For crystallography: Screen lipidic cubic phase (LCP) formulations

  • For cryo-EM: Consider nanodisc or amphipol reconstitution to maintain native environment

  • Verify functional integrity through in vitro enzymatic assays measuring the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate

This methodology integrates approaches used for related prenyl transferases and should provide sufficient quantities of purified, active enzyme suitable for structural determination.

How can researchers effectively measure ubiA enzyme activity in recombinant S. flexneri strains?

Measuring ubiA enzyme activity in recombinant S. flexneri strains requires specialized approaches due to the membrane-bound nature of the enzyme and the complexity of its substrates. A comprehensive protocol involves multiple complementary techniques:

In Vivo Activity Assessment:

  • Quantify ubiquinone (UQ8) levels using HPLC or LC-MS/MS analysis of cellular extracts

  • Compare UQ8 production between wild-type, ΔubiA mutants, and recombinant strains

  • Measure membrane potential using fluorescent probes such as DiOC2(3), which correlates with functional ubiquinone production

In Vitro Enzymatic Assays:

  • Prepare membrane fractions from recombinant S. flexneri strains

  • Set up reaction mixtures containing:

    • Solubilized membrane fractions (enzyme source)

    • 4-hydroxybenzoate (substrate)

    • Octaprenyl pyrophosphate (substrate)

    • Appropriate buffer system (typically phosphate buffer, pH 7.0-7.5)

    • Mg²⁺ or Mn²⁺ (cofactors)

  • Monitor reaction progress through:

    • HPLC detection of 3-octaprenyl-4-hydroxybenzoate formation

    • Radiometric assays using ¹⁴C-labeled 4-hydroxybenzoate

    • Coupled spectrophotometric assays measuring pyrophosphate release

Inhibition Studies:
Inhibition studies provide valuable insights into enzyme function and can be used to validate activity measurements. For example, treating samples with DHB, a known UbiA inhibitor, should result in reduced enzyme activity and decreased membrane potential . The concentration-dependent effects should be documented to establish a clear relationship between inhibitor concentration and enzyme activity.

What are the key considerations for designing inhibitors targeting ubiA in S. flexneri?

Designing effective inhibitors targeting ubiA in S. flexneri requires careful consideration of the enzyme's structure, function, and cellular context. Based on current research, the following key considerations should guide inhibitor design:

Structural Considerations:

  • Target the highly conserved catalytic pockets containing essential active site residues (Asp191 and Arg72) that are necessary for binding 4-hydroxybenzoate (4-HB)

  • Design compounds that can compete with either 4-HB or octaprenyl pyrophosphate substrates

  • Consider the membrane-embedded nature of UbiA when optimizing physicochemical properties of inhibitors

Mechanism-Based Approaches:

  • Develop transition state analogs that mimic the reaction intermediate during prenyl transfer

  • Design covalent inhibitors targeting nucleophilic residues near the active site

  • Consider dual-action inhibitors that may form toxic products when processed by UbiA, as suggested by observations that UbiA overexpression can increase susceptibility to certain inhibitors

Selectivity Considerations:

  • Leverage differences between bacterial UbiA and human homologs (like COQ2) to ensure selectivity

  • Focus on compounds that exploit the high conservation of catalytic sites in bacterial UbiA while avoiding human counterparts

  • Consider species-specific variations in substrate binding pockets for designing narrow-spectrum inhibitors

Empirical Testing Framework:
Establish a comprehensive testing cascade to evaluate potential inhibitors:

Testing LevelAssaysPurpose
Biochemical screeningIn vitro enzymatic assaysIdentify compounds with direct inhibitory activity
Cellular validationGrowth inhibition, membrane potential measurementConfirm cellular activity and penetration
Target validationActivity against ΔubiA vs. wild-typeConfirm specificity for UbiA
Mechanism studiesEnzyme kinetics, binding studiesElucidate mode of inhibition
Safety assessmentMammalian cell toxicity, mitochondrial functionEvaluate selectivity over mammalian homologs

DHB represents an excellent model inhibitor, as it demonstrates specific inhibition of UbiA with corresponding effects on membrane potential . The correlation between UbiA catalytic site conservation and DHB potency provides valuable insights into structure-activity relationships that can guide future inhibitor design .

How can growth curves be used to evaluate the phenotypic effects of ubiA modifications in S. flexneri?

Growth curve analysis provides a valuable non-invasive method for evaluating the phenotypic effects of ubiA modifications in S. flexneri. This approach allows researchers to observe the impact of genetic alterations on bacterial growth kinetics and viability over time. Based on previous studies with recombinant S. flexneri strains, the following methodology is recommended:

Experimental Setup:

  • Prepare overnight cultures of wild-type S. flexneri, ubiA mutants, and recombinant strains in appropriate media

  • Dilute cultures to standardized starting OD600 (typically 0.05-0.1)

  • Grow cultures at 37°C with continuous shaking

  • Measure OD600 at regular intervals (30-60 minutes) for at least 22 hours to capture all growth phases

Key Parameters to Calculate:

  • Generation time (doubling time): Calculate from the exponential phase portion of the growth curve

  • Lag phase duration: Time until exponential growth begins

  • Maximum cell density: Highest OD600 achieved during stationary phase

  • Death phase onset: Time point when OD600 begins to decline

  • Growth rate: Slope of the exponential phase in logarithmic scale

Data Interpretation:
Research with recombinant S. flexneri strains has shown that ubiA modifications can affect growth characteristics in specific ways. For example, ΔtolR mutant strains (which have enhanced capacity to release vesicles) typically reach stationary phase with lower absorbance levels compared to wild-type strains . Double recombinant strains may exhibit a shorter stationary phase, entering the death phase earlier (e.g., at 13 hours compared to wild-type strains that remain stable beyond 22 hours) .

Advanced Analysis:
To gain deeper insights, researchers should consider:

  • Conducting growth experiments under various stress conditions (oxidative stress, antibiotic exposure, nutrient limitation)

  • Combining growth curve data with other phenotypic measurements such as membrane potential analysis using DiOC2(3)

  • Correlating growth parameters with measurements of ubiquinone production levels

  • Performing competition assays between wild-type and modified strains to assess fitness costs

This comprehensive growth curve analysis protocol provides a robust foundation for characterizing the physiological impact of ubiA modifications in S. flexneri, allowing researchers to quantitatively assess how alterations to this critical enzyme affect bacterial fitness and viability.

How does modification of ubiA impact antibiotic susceptibility in S. flexneri?

Modification of ubiA can significantly impact antibiotic susceptibility in S. flexneri through multiple mechanisms related to membrane integrity, energy metabolism, and stress responses. Studies with recombinant S. flexneri strains have provided valuable insights into these relationships:

Mechanistic Connections:

  • Membrane Potential Effects: Since UbiA is essential for ubiquinone biosynthesis, its modification can alter membrane potential . Many antibiotics, particularly aminoglycosides, rely on membrane potential for uptake and efficacy. Decreased membrane potential due to ubiA dysfunction may reduce susceptibility to these antibiotics.

  • Energy-Dependent Processes: Many efflux pumps require energy from the electron transport chain to export antibiotics. UbiA dysfunction could impair these pumps, potentially increasing susceptibility to antibiotics that are normally effluxed.

  • Stress Responses: Alterations in ubiquinone levels due to ubiA modification may trigger bacterial stress responses that can either increase or decrease antibiotic tolerance depending on the specific mechanisms activated.

Experimental Approach to Evaluate Changes:
When studying how ubiA modifications affect antibiotic susceptibility, researchers should:

  • Perform comprehensive antibiotic susceptibility testing using standardized methods (broth microdilution, disk diffusion, or automated systems)

  • Measure changes in membrane potential using fluorescent probes like DiOC2(3)

  • Assess expression of efflux pumps and stress response genes

  • Consider synergistic effects with known UbiA inhibitors like DHB

Understanding these relationships is particularly valuable for developing combination therapies that might target both UbiA function and conventional antibiotic targets simultaneously.

What methods can be used to determine if a small molecule inhibits S. flexneri growth through ubiA inhibition?

Determining whether a small molecule inhibits S. flexneri growth specifically through ubiA inhibition requires a systematic approach combining genetic, biochemical, and physiological methods. Based on research with known UbiA inhibitors like DHB, the following comprehensive methodology is recommended:

Genetic Validation Approaches:

  • Comparative susceptibility testing:

    • Test the compound against wild-type S. flexneri and ΔubiA mutant strains

    • A true UbiA inhibitor will show activity against wild-type strains but minimal or no inhibition of ΔubiA mutants, as observed with DHB

  • Target overexpression studies:

    • Overexpress ubiA using inducible promoters in S. flexneri

    • Monitor changes in compound MIC values

    • Unique to UbiA: Overexpression may lead to a small decrease in MIC rather than resistance, potentially indicating the formation of a toxic product

Biochemical Assays:

  • In vitro UbiA enzyme inhibition assays:

    • Measure the compound's direct effect on purified UbiA or membrane fractions containing UbiA

    • Determine IC50 values and mechanism of inhibition (competitive vs. non-competitive)

  • Substrate competition studies:

    • Test whether excess 4-hydroxybenzoate or octaprenyl pyrophosphate can rescue inhibition

    • Analyze binding site interactions through structural or computational approaches

Physiological Consequences:

  • Ubiquinone level measurement:

    • Quantify UQ8 levels in treated and untreated bacteria using HPLC or LC-MS

    • A true UbiA inhibitor should reduce ubiquinone levels in a dose-dependent manner

  • Membrane potential assessment:

    • Measure changes in membrane potential using fluorescent probes like DiOC2(3)

    • UbiA inhibitors like DHB cause a decrease in membrane potential

  • NADH oxidation rates:

    • Monitor the bacterium's ability to oxidize NADH, which requires functional ubiquinone

    • Reduced rates would support UbiA inhibition

Structural Analysis:

  • Examine conservation of catalytic sites:

    • Analyze correlation between compound potency and conservation of UbiA catalytic sites (Asp191, Arg72) across bacterial species

    • Strong correlation supports specific UbiA targeting

  • Molecular docking and modeling:

    • Predict binding interactions between the compound and UbiA active sites

    • Validate predictions through site-directed mutagenesis of key residues

This comprehensive approach provides multiple lines of evidence to confidently determine whether a small molecule specifically inhibits S. flexneri growth through UbiA inhibition rather than through other mechanisms.

How conserved is ubiA across different Shigella species and other Enterobacteriaceae?

The 4-hydroxybenzoate octaprenyltransferase (ubiA) gene exhibits remarkable conservation across Shigella species and other members of the Enterobacteriaceae family, reflecting its essential role in ubiquinone biosynthesis. Extensive comparative genomic analysis reveals several key aspects of this conservation:

Sequence Conservation:
UbiA demonstrates high sequence homology across Enterobacteriaceae, with particularly strong conservation in the catalytic domains. The critical active site residues, specifically Asp191 and Arg72, which are necessary for binding 4-hydroxybenzoate (4-HB), are highly conserved across Escherichia coli, Enterobacter cloacae, Klebsiella pneumoniae, Serratia marcescens, Proteus mirabilis, and Acinetobacter baumannii . This conservation extends to Shigella species, with S. flexneri showing particularly high similarity to E. coli ubiA, reflecting their close evolutionary relationship.

Functional Conservation:
The high degree of sequence conservation translates to functional similarity. The correlation between conserved catalytic sites and susceptibility to UbiA inhibitors like DHB demonstrates this functional conservation . Studies show that bacteria with highly conserved catalytic sites display similar sensitivity patterns to UbiA inhibitors, indicating that the enzyme's mechanism of action is preserved across these species .

Evolutionary Context:
The ubiquinone biosynthesis pathway, including ubiA, represents an ancient and essential metabolic pathway that emerged early in bacterial evolution. The pathway is present across diverse bacterial phyla, though specific adaptations exist. Within Enterobacteriaceae, ubiA shows signs of purifying selection, with limited non-synonymous substitutions, particularly in catalytic regions. This pattern of conservation suggests strong evolutionary pressure to maintain UbiA function due to its critical role in cellular respiration.

Taxonomic Distribution:
The table below summarizes key aspects of ubiA conservation across selected Enterobacteriaceae members:

SpeciesUbiA Sequence Identity to S. flexneriConservation of Active Site Residues (Asp191, Arg72)Functional Response to UbiA Inhibitors
Escherichia coli>95%CompleteHighly sensitive
Enterobacter cloacae>90%CompleteSensitive
Klebsiella pneumoniae>90%CompleteSensitive
Serratia marcescens>85%CompleteSensitive
Proteus mirabilis>80%CompleteSensitive
Acinetobacter baumannii>75%CompleteSensitive

This high degree of conservation makes ubiA an attractive target for broad-spectrum antimicrobial development, as inhibitors designed against this enzyme could potentially be effective against multiple Enterobacteriaceae species .

How can researchers troubleshoot expression problems when working with recombinant ubiA in heterologous systems?

Expressing recombinant ubiA in heterologous systems presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. Researchers encountering expression problems should implement a systematic troubleshooting approach to identify and resolve specific issues:

Common Expression Challenges and Solutions:

  • Toxicity to Host Cells

    • Symptom: Poor growth of transformed cells, plasmid instability

    • Solutions:

      • Use tightly regulated inducible promoters (e.g., araBAD, tetO)

      • Lower growth temperature (16-20°C) during induction

      • Reduce inducer concentration

      • Use specialized expression strains (C41/C43) designed for toxic membrane proteins

  • Protein Misfolding and Aggregation

    • Symptom: Protein found primarily in inclusion bodies

    • Solutions:

      • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

      • Add membrane-stabilizing agents (glycerol 5-10%)

      • Include cofactors in growth media (e.g., octaprenyl pyrophosphate)

      • Consider fusion partners that enhance folding (MBP, thioredoxin)

  • Poor Translation Efficiency

    • Symptom: Low protein yield despite good mRNA levels

    • Solutions:

      • Optimize codon usage for the expression host

      • Check for rare codons clusters and modify if necessary

      • Ensure proper ribosome binding site spacing

      • Consider using translation enhancer elements

  • Proteolytic Degradation

    • Symptom: Multiple lower molecular weight bands on Western blot

    • Solutions:

      • Use protease-deficient strains (e.g., BL21)

      • Add protease inhibitors during extraction

      • Optimize extraction conditions (pH, salt concentration)

      • Consider C-terminal rather than N-terminal tags

Diagnostic Approaches and Optimization Strategy:

StageDiagnostic TestOptimization Strategy
Gene designSequence analysis for rare codons, secondary structuresCodon optimization, remove RNA secondary structures
TransformationColony PCR, restriction analysisVerify plasmid integrity, consider low-copy vectors
Expression conditionsSmall-scale expression trials with varying conditionsTest matrix of temperatures, induction times, and inducer concentrations
Protein detectionWestern blot with anti-tag antibodiesTry different extraction methods (detergents, lysis conditions)
Functional verificationIn vitro enzymatic assay, complementation studiesVerify activity of expressed protein to confirm proper folding

Case-Specific Considerations for ubiA:
For ubiA specifically, consider the following:

  • Membrane localization is critical for proper folding and function; ensure adequate membrane space by avoiding overexpression

  • Supplement growth media with substrates (4-hydroxybenzoate) or cofactors to stabilize the protein during expression

  • When extracting the protein, test multiple detergents for solubilization (DDM, LMNG, CHAPS) at varying concentrations

  • Consider expressing ubiA in specialized lipid environments or nanodiscs for structural studies

By systematically addressing these potential issues, researchers can overcome common challenges in recombinant ubiA expression and proceed with functional and structural characterization of this important enzyme.

How should researchers interpret unexpected results when studying ubiA function in recombinant S. flexneri?

When encountering unexpected results in studies of ubiA function in recombinant S. flexneri, researchers should employ a systematic framework for interpretation and troubleshooting. Unexpected findings often represent valuable opportunities for new discoveries rather than experimental failures. The following structured approach is recommended:

Framework for Interpreting Unexpected Results:

  • Validate the Observation

    • Confirm reproducibility through multiple independent experiments

    • Verify using complementary methodologies (e.g., if growth defects are observed, confirm with multiple growth measurement techniques)

    • Rule out technical artifacts through appropriate controls

  • Consider Established Biological Context

    • Compare results with known UbiA functions in ubiquinone biosynthesis

    • Review literature for similar phenomena in related enzymes or organisms

    • Consider pathway interactions (e.g., unexpected results might reflect interactions between ubiquinone biosynthesis and other metabolic pathways)

  • Explore Alternative Hypotheses

    • Consider pleiotropic effects: UbiA modification may affect multiple cellular processes beyond ubiquinone biosynthesis

    • Investigate compensatory mechanisms: Bacteria often activate alternative pathways when primary ones are disrupted

    • Examine strain-specific factors: Genetic background differences may explain unexpected results

  • Reconcile with Existing Knowledge

    • Look for precedent in related systems (e.g., E. coli UbiA studies)

    • Consider whether findings expand or challenge current models

    • Evaluate whether results suggest novel functions for UbiA

Examples of Unexpected Results and Interpretations:

Unexpected ObservationPotential InterpretationFollow-up Experiments
UbiA overexpression increases antibiotic sensitivityFormation of toxic metabolic intermediates Metabolomic analysis, identify accumulated intermediates
ΔubiA mutants show conditional viabilityAlternative electron acceptors may be utilized under specific conditionsTest growth under various electron acceptor conditions
Recombinant strains show altered virulenceUbiA function may affect virulence factor expressionTranscriptomic or proteomic comparison with wild-type
Variable phenotypes across growth phasesTemporal regulation of ubiquinone requirementsTime-course studies of ubiquinone levels and energy demands

When faced with contradictory data, researchers should thoroughly examine the findings, identify specific discrepancies, and evaluate initial assumptions and research design . Alternative explanations should be systematically tested, and modified data collection processes may be necessary . Remember that unexpected findings in molecular biology often lead to significant advances in understanding fundamental biological processes.

What statistical methods are most appropriate for analyzing enzyme kinetics data from recombinant ubiA studies?

Analyzing enzyme kinetics data from recombinant ubiA studies requires robust statistical approaches that account for the complexities of membrane-bound enzymes and the challenges of working with lipophilic substrates. The following statistical methods are recommended for rigorous analysis of ubiA enzyme kinetics:

Fundamental Kinetic Parameter Estimation:

  • Nonlinear Regression for Michaelis-Menten Kinetics

    • Use nonlinear regression rather than linearization methods (like Lineweaver-Burk) for direct fitting of the Michaelis-Menten equation:
      v = (Vmax × [S]) / (Km + [S])

    • Report confidence intervals for Km and Vmax rather than just point estimates

    • Consider using weighted nonlinear regression when variance is heteroscedastic (common with spectrophotometric assays)

  • Enzyme Inhibition Analysis

    • Apply competitive, uncompetitive, noncompetitive, or mixed inhibition models based on preliminary data

    • Use global fitting approaches that simultaneously analyze multiple inhibitor concentrations

    • Calculate inhibition constants (Ki) with appropriate confidence intervals

    • For UbiA inhibitors like DHB, analyze dose-response relationships to determine IC50 values

Advanced Statistical Approaches:

  • Model Discrimination Methods

    • Use Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to select between competing kinetic models

    • Perform F-tests to compare nested models when appropriate

    • Apply likelihood ratio tests to determine whether complex models provide statistically better fits

  • Robust Regression Techniques

    • Implement methods resistant to outliers (common in membrane enzyme studies)

    • Consider using bisquare or Huber weighting functions

    • Compare results from multiple robust methods to ensure consistency

Experimental Design Considerations:

Experimental ApproachStatistical MethodApplication to ubiA
Factorial designsANOVA with interaction termsAnalyze effects of multiple factors (pH, temperature, detergent) on ubiA activity
Response surface methodologyMultiple regression with quadratic termsOptimize reaction conditions for maximum ubiA activity
Progress curve analysisIntegrated rate equationsStudy ubiA kinetics without initial rate approximations
Global data fittingSimultaneous equation systemsAnalyze complex reaction mechanisms with multiple substrates

Software Recommendations:

  • GraphPad Prism: User-friendly interface with built-in enzyme kinetics models

  • R with packages like 'drc' for dose-response curves and 'nlstools' for nonlinear regression diagnostics

  • Python with SciPy and specialized packages like 'pyenzyme' for more customizable analysis

  • KinTek Explorer for mechanism-based global fitting of complex kinetic mechanisms

When reporting results, always include:

  • Number of replicates (biological and technical)

  • Goodness-of-fit statistics (R², residual plots)

  • Parameter estimates with confidence intervals

  • Clear description of the kinetic model used and justification for model selection

This comprehensive statistical approach ensures robust analysis of ubiA enzyme kinetics data, facilitating valid comparisons between different recombinant variants or inhibitor studies.

What are promising future research directions for studying ubiA in S. flexneri?

The study of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Shigella flexneri represents a rich area for future investigation, with several promising research directions that could significantly advance our understanding of bacterial metabolism, antibiotic resistance, and vaccine development. Based on current research trends and emerging technologies, the following areas offer particularly promising opportunities:

Structural Biology and Mechanism Studies:

  • High-resolution structural determination of S. flexneri UbiA using cryo-electron microscopy or X-ray crystallography

  • Investigation of conformational changes during catalysis through EPR or FRET studies

  • Elucidation of substrate channeling mechanisms between UbiA and other enzymes in the ubiquinone biosynthesis pathway

  • Detailed mechanistic studies of the prenyl transfer reaction using isotope labeling and time-resolved spectroscopy

Antimicrobial Development:

  • Structure-based design of selective UbiA inhibitors based on the highly conserved catalytic sites (Asp191 and Arg72)

  • Exploration of the unusual phenomenon where UbiA overexpression can increase susceptibility to certain inhibitors

  • Development of combination therapies targeting both UbiA and other cellular processes

  • Investigation of resistance mechanisms that might emerge against UbiA inhibitors

Metabolic Engineering and Synthetic Biology:

  • Engineering S. flexneri strains with modified UbiA to produce altered ubiquinone variants for bioenergy applications

  • Development of biosensors based on UbiA activity for high-throughput screening

  • Creation of synthetic metabolic pathways that leverage UbiA's prenylation capabilities for production of high-value compounds

  • Engineering strains with regulated UbiA expression for controlled growth in biotechnology applications

Vaccine Development Applications:

  • Further development of recombinant S. flexneri outer membrane vesicles (OMVs) as vaccine delivery platforms

  • Investigation of UbiA's role in membrane composition and its impact on OMV formation and immunogenicity

  • Creation of attenuated vaccine strains through controlled modification of UbiA expression

  • Development of bivalent or multivalent vaccines targeting both S. flexneri and other pathogens using the recombinant approach demonstrated with ETEC antigens

Systems Biology Approaches:

  • Multi-omics investigation of the global cellular response to UbiA inhibition or modification

  • Network analysis of interactions between ubiquinone biosynthesis and other metabolic pathways

  • Computational modeling of electron transport chain dynamics in response to altered UbiA activity

  • Single-cell studies of heterogeneity in UbiA expression and its impact on bacterial population dynamics

These research directions build upon current knowledge while leveraging emerging technologies to address fundamental questions about UbiA function and its potential applications in medicine and biotechnology.

How might CRISPR-Cas9 technology be used to advance research on ubiA in S. flexneri?

CRISPR-Cas9 technology offers powerful approaches for advancing research on ubiA in Shigella flexneri through precise genome editing, regulation of gene expression, and high-throughput screening. This versatile tool can be applied to multiple aspects of ubiA research, from fundamental studies to applied applications in vaccine development and antimicrobial discovery:

Precise Genome Editing Applications:

  • Gene Replacement and Modification

    • Create precise point mutations in conserved catalytic residues (Asp191, Arg72) to study structure-function relationships

    • Generate scarless deletions of ubiA with minimal polar effects on neighboring genes

    • Introduce tagged versions of ubiA (e.g., fluorescent proteins, affinity tags) at the native locus for in situ studies

  • Pathway Engineering

    • Simultaneously modify multiple genes in the ubiquinone biosynthesis pathway to study synthetic interactions

    • Introduce orthologous ubiA genes from other organisms to assess functional conservation

    • Create chimeric enzymes by swapping domains between UbiA and related prenyltransferases

  • Recombinant Strain Development

    • Engineer precise genomic integration of heterologous antigens similar to the eltb gene integration approach

    • Generate libraries of ubiA variants with altered substrate specificity or catalytic properties

    • Create conditional knockouts using inducible systems for temporal control of ubiA expression

Gene Expression Regulation:

  • CRISPRi for Conditional Knockdown

    • Deploy catalytically inactive Cas9 (dCas9) with guide RNAs targeting ubiA to achieve tunable repression

    • Create graded phenotypes by varying the degree of ubiA expression reduction

    • Study the threshold levels of UbiA required for various cellular functions

  • CRISPRa for Overexpression Studies

    • Use CRISPR activation systems to upregulate ubiA expression from its native locus

    • Study the consequences of UbiA overexpression on membrane composition and antibiotic susceptibility

    • Create strains with enhanced ubiquinone production for metabolic engineering applications

High-throughput Screening Applications:

Screening ApproachImplementationExpected Outcome
Pooled CRISPR screensGenerate genome-wide guide RNA librariesIdentify genes that synthetically interact with ubiA
Base editing screensDeploy cytidine or adenine base editorsMap the functional importance of specific amino acids in UbiA
CRISPR interference screensTarget different regions of ubiAIdentify minimal expression requirements in various conditions
Combinatorial editingMultiplex CRISPR to target multiple pathway genesReveal pathway interactions and regulatory relationships

Technical Considerations for S. flexneri:

  • Optimize Cas9 delivery systems specifically for S. flexneri (plasmid-based vs. chromosomally integrated)

  • Develop efficient transformation protocols to overcome potential barriers to introducing CRISPR components

  • Select appropriate promoters for Cas9 expression that function well in S. flexneri

  • Design guide RNAs with minimal off-target effects by leveraging S. flexneri genome sequence information

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.