Recombinant Shigella flexneri serotype 5b Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

DsbB is a membrane-bound oxidoreductase that regenerates the catalytic activity of DsbA, a periplasmic disulfide bond isomerase essential for the proper folding of virulence factors such as invasion plasmid antigen (Ipa) proteins . In Shigella flexneri serotype 5b, DsbB ensures the oxidative folding of proteins required for:

  • Type III secretion system (T3SS) assembly

  • Intercellular spread through epithelial protrusions

  • Neutralization of cytoplasmic glutathione-mediated reducing environments

Mechanism of Action

  • DsbB transfers electrons from DsbA to respiratory quinones, reoxidizing DsbA for subsequent catalytic cycles .

  • This activity is critical for the secretion of IpaB and IpaC, which mediate bacterial invasion and cell-to-cell spread .

Experimental Evidence

  • Knockout Mutants: dsbB mutants (e.g., Sh42) show delayed secretion kinetics of Ipa proteins and fail to lyse protrusions in host cells .

  • Complementation: Expression of recombinant DsbB in trans restores wild-type virulence phenotypes .

Recombinant Production and Purification

Recombinant DsbB is typically expressed in E. coli systems with affinity tags (e.g., His-tag) for purification. Data from analogous Shigella proteins (e.g., DsbD) provide methodological insights :

ParameterDetails
Expression SystemE. coli (e.g., BL21(DE3)) with pET or pMMB66 vectors
TagN-terminal His-tag for nickel affinity chromatography
Purity>90% (verified by SDS-PAGE)
StorageLyophilized or in Tris/PBS buffer with 50% glycerol at -80°C

Applications in Research

  • Pathogenesis Studies: Used to dissect redox-dependent virulence mechanisms in Shigella .

  • Vaccine Development: DsbB-derived epitopes are candidates for multiepitope vaccines targeting Shigella spp. .

  • Antimicrobial Targets: Inhibition of DsbB disrupts bacterial protein folding, offering therapeutic potential .

Comparative Genomics

The dsbB gene is conserved across S. flexneri serotypes, but serotype 5b lacks pathogenicity islands (e.g., SHI-1) present in serotype 2a, suggesting divergent evolutionary pressures . Despite this, DsbB’s role in redox homeostasis remains critical in all serotypes .

Future Directions

  • Structural Studies: Cryo-EM analysis to resolve DsbB-DsbA interaction dynamics.

  • Inhibitor Screening: High-throughput assays to identify small molecules targeting DsbB’s quinone-binding pocket.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbB; SFV_1192; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
dsbB
Target Protein Sequence
MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWV PQVFVASGDCAERQWDFLGMEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR
Uniprot No.

Target Background

Function

Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.

Database Links

KEGG: sfv:SFV_1192

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of DsbB in Shigella flexneri 5b?

DsbB in S. flexneri 5b functions as a critical enzyme in the disulfide bond formation pathway, similar to its homolog in E. coli. It is a cytoplasmic membrane protein that oxidizes the periplasmic enzyme DsbA, which directly catalyzes disulfide bond formation in secreted proteins. DsbB maintains DsbA in its oxidized state by transferring electrons from DsbA to quinones in the electron transport chain, making it an essential link between protein folding and cellular respiration. This oxidation-reduction cycle is crucial for the proper folding and stability of many virulence factors in S. flexneri that contain disulfide bonds .

How does the structural conservation of DsbB compare between S. flexneri 5b and other bacterial species?

Genomic analysis shows that DsbB is highly conserved between S. flexneri 5b strain 8401 and S. flexneri 2a strain 301, reflecting the high level of structural and functional conservation between these serotypes. This conservation extends to key functional residues such as the four essential cysteine residues (Cys41, Cys44, Cys104, and Cys130) that participate in disulfide exchange reactions, and the highly conserved arginine residue at position 48 that plays a critical role in interactions with quinones. Despite this conservation, selective pressures during evolution have led to subtle differences that may contribute to variations in virulence between serotypes .

What are the key functional domains of DsbB in S. flexneri 5b?

DsbB in S. flexneri 5b contains several functional domains similar to its E. coli counterpart:

Domain/FeatureAmino Acid PositionFunction
Transmembrane segmentsFour membrane-spanning regionsAnchoring in cytoplasmic membrane
Periplasmic loop 1Contains Cys41-Cys44 pairInitial disulfide exchange with DsbA
Periplasmic loop 2Contains Cys104-Cys130 pairElectron transfer to quinones
Arginine 48Position 48Critical for quinone interaction

The cysteines form two pairs (Cys41-Cys44 and Cys104-Cys130) that participate in sequential disulfide exchange reactions essential for the enzyme's catalytic cycle .

What are the recommended methods for purifying recombinant S. flexneri 5b DsbB for in vitro studies?

Purification of recombinant S. flexneri 5b DsbB requires specialized approaches for membrane proteins:

  • Expression system optimization: Clone the dsbB gene from S. flexneri 5b genomic DNA into an expression vector with a His-tag or other affinity tag.

  • Membrane fraction isolation: After cell lysis, separate membrane fractions by ultracentrifugation.

  • Detergent solubilization: Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DM) at 0.1% (w/v) to maintain protein activity.

  • Affinity chromatography: Purify using immobilized metal affinity chromatography (IMAC).

  • Size exclusion chromatography: Further purify by gel filtration to remove aggregates.

  • Activity verification: Confirm functional activity through the ability to oxidize reduced DsbA in the presence of ubiquinone or menaquinone.

During purification, it's crucial to maintain the protein in its native redox state by avoiding reducing agents unless specifically studying reduced forms of the protein .

How can researchers accurately determine the redox state of DsbB cysteines in experimental settings?

Determining the redox state of DsbB cysteines requires methods that can trap and differentiate between oxidized and reduced states:

  • AMS or IAM modification: Treat samples with trichloroacetic acid (TCA) to precipitate proteins and block thiol-disulfide exchange, then modify free thiols with 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid (AMS) or iodoacetamide (IAM). AMS adds ~500 Da per free thiol, creating a mobility shift visible on SDS-PAGE.

  • Mass spectrometry: Use electrospray ionization mass spectrometry (ESI-MS) to precisely measure mass differences between oxidized and reduced/modified states. This technique can detect differences of ~40 Da between calculated and measured masses.

  • Differential labeling: Sequentially use thiol-reactive probes with different properties (e.g., IAM followed by NEM) to distinguish between different cysteine pairs.

  • Redox potential determination: Equilibrate DsbB with glutathione redox buffers of varying [GSH]²/[GSSG] ratios to determine the redox potential of specific disulfide bonds. For example, the Cys41-Cys44 and Cys104-Cys130 disulfide bonds have been measured with potentials around -271 mV and -284 mV, respectively .

What expression systems are most suitable for producing functional recombinant S. flexneri 5b DsbB?

For producing functional recombinant S. flexneri 5b DsbB:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, easy handlingMay form inclusion bodiesInitial screening, mutagenesis studies
E. coli C41/C43Specialized for membrane proteinsLower yield than BL21Functional studies requiring native folding
E. coli dsbB knockoutAllows complementation testingRequires specialized strain constructionFunctional validation studies
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldDifficult-to-express variants

For optimal expression, use a temperature of 30°C rather than 37°C after induction, add 0.5-1% glucose to the media to control leaky expression, and induce with a lower IPTG concentration (0.1-0.5 mM) to promote proper membrane insertion. Supplementing the media with cofactors such as ubiquinone or menaquinone may also improve the yield of functional protein .

How does S. flexneri 5b DsbB differ from its counterparts in other Shigella serotypes and species?

AspectS. flexneri 5b vs. S. flexneri 2aFunctional Implications
Amino acid sequence>98% identityCore functions preserved
Regulatory elementsMinor differences in promoter regionsPotential differences in expression levels
Interaction partnersVariations in periplasmic protein compositionMay affect substrate specificity

These differences, while subtle, may contribute to the distinct pathogenic properties observed between S. flexneri serotypes, particularly in the context of host-pathogen interactions and immune recognition .

What evolutionary insights can be gained from studying DsbB across different Shigella strains?

Evolutionary analysis of DsbB across Shigella strains provides several key insights:

  • Conservation of catalytic mechanism: The high conservation of the four catalytic cysteines and the arginine 48 residue across all strains indicates that the fundamental disulfide exchange mechanism is evolutionarily ancient and essential.

  • Serotype divergence: The divergence of S. flexneri serotypes, including 5b, appears to have occurred after the acquisition of pathogenicity islands SHI-1 and SHI-2, with subsequent integration of SHI-O. This chronology helps establish the evolutionary timeline of Shigella speciation.

  • Selection pressure: DsbB shows evidence of purifying selection (conservation of function), unlike some virulence factors that show diversifying selection in response to host immune pressure. This suggests DsbB's function is critical for basic cellular processes beyond just virulence.

  • Horizontal gene transfer: Comparison of genomic contexts suggests that dsbB was likely present in the common ancestor of E. coli and Shigella, rather than acquired through horizontal gene transfer, reinforcing its fundamental role in bacterial physiology .

What is the current understanding of the DsbB catalytic cycle in S. flexneri 5b?

The catalytic cycle of DsbB in S. flexneri 5b follows a complex series of disulfide exchange reactions:

  • Initial state: Oxidized DsbB contains disulfide bonds between Cys41-Cys44 and Cys104-Cys130.

  • DsbA interaction: Reduced DsbA attacks the Cys104-Cys130 disulfide of DsbB, forming a mixed disulfide intermediate between DsbA Cys30 and DsbB Cys104.

  • Intramolecular rearrangement: Within DsbB, electrons transfer from the Cys41-Cys44 pair to resolve the mixed disulfide, resulting in oxidized DsbA and reduced DsbB.

  • Quinone reduction: Reduced DsbB transfers electrons to ubiquinone (aerobic conditions) or menaquinone (anaerobic conditions), regenerating the oxidized form of DsbB.

This cycle is regulated by the redox state of the quinone pool, which links disulfide bond formation to cellular respiration. The highly conserved arginine residue at position 48 plays a critical role in the interaction with quinones, particularly affecting the enzyme's ability to utilize menaquinone under anaerobic conditions .

How do mutations in the conserved arginine residue (R48) affect DsbB function?

Mutations in the conserved arginine residue at position 48 significantly impact DsbB function:

MutationBiochemical EffectPhenotypic Consequence
R48HIncreased Km for ubiquinone (7x wild-type)
Very low activity with menaquinone
Functions well aerobically
Severely impaired anaerobically
R48CSimilar to R48H but with distinct mixed disulfide characteristicsFunctions well aerobically
Severely impaired anaerobically

These mutations particularly affect the enzyme's ability to interact with quinones:

  • Enhanced DsbA-DsbB complex accumulation: Both R48H and R48C mutations cause increased accumulation of a mixed disulfide complex between DsbA and DsbB under aerobic conditions, suggesting impaired resolution of this intermediate.

  • Quinone specificity: The mutations dramatically reduce the ability of DsbB to utilize menaquinone, explaining the anaerobic growth defect.

  • Redox sensing: The data suggests that R48 plays a role in sensing or responding to changes in the quinone pool composition that occur during transitions between aerobic and anaerobic growth.

These findings indicate that R48 is a key residue that connects the disulfide exchange activity of DsbB to the respiratory electron transport chain through quinone interaction .

What is the relationship between DsbB function and quinone utilization in S. flexneri 5b?

DsbB in S. flexneri 5b, like its E. coli counterpart, utilizes different quinones depending on oxygen availability:

  • Aerobic conditions: DsbB preferentially uses ubiquinone (UQ-8) as an electron acceptor, which is then reoxidized by the aerobic respiratory chain.

  • Anaerobic conditions: DsbB shifts to using menaquinone (MK-8) and demethylmenaquinone (DMK-8), which are predominant in the anaerobic respiratory chain.

This quinone switching mechanism efficiently links disulfide bond formation to the prevailing respiratory mode of the bacterium. The conserved arginine at position 48 plays a crucial role in this process, as it appears to be involved in the binding or reduction of quinones, particularly menaquinone. Mutations in this residue (R48H, R48C) severely impair DsbB function under anaerobic conditions, suggesting that the interaction between R48 and menaquinone is particularly important. This relationship between DsbB and the quinone pool represents a sophisticated regulatory mechanism that ensures continued disulfide bond formation under varying environmental conditions that S. flexneri might encounter during infection .

How can researchers design effective experiments to study DsbB-dependent virulence factor maturation in S. flexneri 5b?

To effectively study DsbB-dependent virulence factor maturation in S. flexneri 5b:

  • Identify target virulence factors: Begin by conducting bioinformatic analysis to identify secreted virulence factors containing disulfide bonds that are likely DsbB-dependent.

  • Generate conditional DsbB mutants:

    • Create an IPTG-inducible or temperature-sensitive DsbB expression system in S. flexneri 5b

    • Develop site-specific DsbB mutants (e.g., C41S/C44S, C104S/C130S, R48H) to disrupt specific aspects of the catalytic cycle

  • Establish phenotypic assays:

    • Invasion efficiency in cell culture models

    • Virulence factor secretion/activity assays

    • Tissue culture infection models with impaired DsbB function

  • Implement proper controls:

    • Positive control: Wild-type S. flexneri 5b

    • Negative control: Non-virulent strain lacking a virulence plasmid

    • Experimental control: Complemented DsbB mutant strains

  • Design readouts for disulfide bond formation:

    • Use AMS modification to track the redox state of selected virulence factors

    • Develop activity assays for disulfide-dependent virulence factors

    • Employ proteomics approaches to identify global changes in disulfide proteome

This experimental design follows the principles of the "Experimental Design, Data, and Variables" framework, ensuring proper controls, clearly defined variables, and appropriate data collection methods .

What methods can resolve contradictory findings about DsbB mechanism in different experimental systems?

Resolving contradictory findings about the DsbB mechanism requires systematic approaches:

  • Standardize experimental conditions:

    • Use defined buffer systems with controlled pH, ionic strength, and temperature

    • Ensure consistent detergent concentration and type for membrane protein studies

    • Standardize protein purification protocols to maintain native structure

  • Employ multiple complementary techniques:

    • Compare in vivo (genetic) and in vitro (biochemical) approaches

    • Utilize both equilibrium and kinetic measurements

    • Combine structural studies (e.g., crystallography, NMR) with functional assays

  • Address specific contradictions methodically:

    • For contradictory redox potential measurements: Use multiple reference redox pairs

    • For discrepancies in quinone dependency: Test with defined quinone species and concentrations

    • For conflicting models of the reaction sequence: Perform time-resolved studies to capture intermediates

  • Control for experimental artifacts:

    • Test whether mutations affect protein stability rather than just catalytic function

    • Consider the impact of detergents on quinone binding and protein interactions

    • Verify that tags or fusion partners don't interfere with natural protein function

  • Reconcile models through integrative approaches:

    • Develop mathematical models that can accommodate seemingly contradictory observations

    • Test predictions of competing models with new experimental designs

    • Consider that different mechanisms may operate under different conditions

This systematic approach has proven valuable in resolving contradictions about the DsbB mechanism, such as the debate over direct vs. disulfide-mediated electron transfer to quinones .

How might the study of S. flexneri 5b DsbB contribute to vaccine development strategies?

The study of S. flexneri 5b DsbB can contribute to vaccine development in several strategic ways:

  • Target identification: Since DsbB is essential for the proper folding of many secreted virulence factors, understanding which specific virulence antigens depend on DsbB can help identify promising vaccine targets with native conformational epitopes.

  • Attenuated vaccine strains: Engineering DsbB variants with conditional defects (e.g., R48H mutation that functions aerobically but not anaerobically) could create novel attenuated strains that maintain immunogenicity but have reduced virulence in the anaerobic gut environment.

  • Cross-protection strategies: The high conservation of DsbB across Shigella serotypes suggests that strategies targeting DsbB-dependent processes might provide broader protection than serotype-specific approaches. Comparative analysis of DsbB-dependent antigens across serotypes may identify conserved targets.

  • Adjuvant development: Understanding how DsbB-dependent proteins interact with host pattern recognition receptors may inform the development of adjuvants that enhance immune responses to Shigella vaccines.

  • Combination approaches: Knowledge of how DsbB affects the conformation of key antigens could inform the design of combination vaccines that include both wild-type antigens (for neutralizing antibodies) and DsbB-independent variants (for T-cell responses).

  • In vitro correlates of protection: DsbB-dependent conformational changes in antigens could serve as in vitro correlates of protective immunity, facilitating vaccine evaluation without challenge studies.

This approach builds on the extensive history of Shigella vaccine development, which has shown both progress and challenges over more than 50 years of research .

What are the main technical challenges in studying S. flexneri 5b DsbB and how can they be overcome?

Studying S. flexneri 5b DsbB presents several significant technical challenges:

ChallengeNature of DifficultyPotential Solutions
Membrane protein purificationPoor solubility, loss of native conformationUse mild detergents (0.1% DM), nanodiscs, or amphipols; purify with stabilizing ligands present
Maintaining redox state during analysisSpontaneous oxidation/reduction during handlingPerform manipulations under anaerobic conditions; use rapid alkylation techniques
Reconstituting activity in vitroLoss of quinone cofactors, complex electron transfer chainSupplement with defined quinone species; use native membrane extracts
Resolving reaction intermediatesTransient nature of catalytic intermediatesEmploy rapid kinetic techniques; use trapping mutants (e.g., single-cysteine variants)
Structural characterizationDifficulty in crystallizing membrane proteinsConsider cryo-EM approaches; use fusion partners to aid crystallization

Additionally, researchers should consider employing advanced techniques such as:

  • Site-specific crosslinking to capture transient protein-protein interactions

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Native mass spectrometry for intact membrane protein complexes

  • Single-molecule techniques to observe heterogeneity in catalytic behavior

These approaches can help overcome the intrinsic challenges of working with membrane proteins involved in redox chemistry .

What unanswered questions remain about the comparative properties of DsbB between S. flexneri 5b and other serotypes?

Several important questions remain unanswered about the comparative properties of DsbB between S. flexneri 5b and other serotypes:

  • Substrate specificity: Do subtle differences in DsbB sequence or expression affect the efficiency of disulfide bond formation in serotype-specific virulence factors?

  • Regulatory mechanisms: How do different serotypes regulate dsbB expression in response to environmental conditions encountered during infection?

  • Interaction networks: Does DsbB participate in different protein-protein interaction networks across serotypes that might contribute to differences in virulence?

  • Quinone utilization efficiency: Are there serotype-specific differences in the efficiency of quinone utilization that might affect disulfide bond formation under specific growth conditions?

  • Evolution rate: Does DsbB evolve at different rates in different serotypes, potentially reflecting different selective pressures?

  • Post-translational modifications: Are there serotype-specific differences in any post-translational modifications of DsbB that might modulate its activity?

  • Inhibitor susceptibility: Do small differences in DsbB structure between serotypes affect susceptibility to potential inhibitors?

Addressing these questions requires comparative biochemical and genetic studies across multiple S. flexneri serotypes, with careful attention to standardized experimental conditions .

How might advances in structural biology techniques contribute to our understanding of S. flexneri 5b DsbB function?

Recent advances in structural biology offer promising approaches to deepen our understanding of S. flexneri 5b DsbB function:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of membrane proteins without crystallization

    • Could capture different conformational states during the catalytic cycle

    • May reveal DsbB-DsbA and DsbB-quinone interaction details at near-atomic resolution

  • Integrative structural biology:

    • Combines multiple techniques (X-ray crystallography, NMR, SAXS, crosslinking-MS)

    • Provides complementary structural information at different resolutions

    • Can integrate dynamic information with static structural snapshots

  • Time-resolved structural methods:

    • X-ray free-electron lasers (XFELs) for ultrafast structural changes

    • Time-resolved cryo-EM to capture reaction intermediates

    • Could visualize the sequence of conformational changes during catalysis

  • Molecular dynamics simulations:

    • Prolonged simulations with specialized hardware

    • Enhanced sampling techniques to observe rare events

    • Can model quinone binding and membrane interactions that are difficult to capture experimentally

  • In-cell structural biology:

    • Techniques like in-cell NMR or correlative light and electron microscopy

    • Provides structural information in the native cellular environment

    • Could reveal physiologically relevant interactions and conformations

These approaches could resolve longstanding questions about the mechanism of DsbB, particularly regarding:

  • The structural basis for specificity in the DsbA-DsbB interaction

  • Conformational changes accompanying disulfide exchange reactions

  • The molecular basis for quinone specificity and the role of the conserved R48 residue

  • Differences in structure and dynamics between aerobic and anaerobic states

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.