Recombinant Shigella flexneri serotype 5b Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; SFV_4310; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function
Fumarate and succinate interconversion is catalyzed by two distinct, membrane-bound, FAD-containing enzymes: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links

KEGG: sfv:SFV_4310

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal methods for isolating the frdD gene from Shigella flexneri serotype 5b?

The isolation of frdD from S. flexneri serotype 5b typically employs PCR-based amplification using primers designed from conserved regions of the gene. The recommended approach involves:

  • Genomic DNA extraction using a phenol-chloroform method optimized for Gram-negative bacteria

  • PCR amplification using high-fidelity DNA polymerase with primers spanning the complete open reading frame

  • Verification through colony PCR and restriction enzyme digestion

  • Sequencing confirmation to ensure integrity of the isolated gene

When designing primers, researchers should account for the genomic plasticity observed in S. flexneri, as insertion sequence (IS) elements can mediate significant structural variations across strains . For greatest accuracy, incorporate at least 20bp homology arms flanking the target gene and confirm sequence authenticity against reference genomes.

How do expression levels of recombinant frdD in heterologous systems compare to native expression patterns during S. flexneri infection?

Expression patterns of recombinant frdD differ significantly between heterologous systems and native infection contexts. During infection, frdD expression in S. flexneri responds dynamically to environmental cues, particularly oxygen availability and host-derived signals. Current research indicates:

Expression SystemRelative ExpressionSolubilityActivityNotes
E. coli BL21(DE3)HighModerate (40-60%)65-80% of nativeRequires optimization of induction parameters
E. coli Arctic ExpressModerateHigh (>70%)80-90% of nativeBetter folding at low temperatures
Cell-free systemsVariableLow (~30%)40-50% of nativeUseful for toxic protein expression
Native S. flexneri (infection model)DynamicHigh100% (reference)Expression peaks under anaerobic conditions

To accurately replicate native expression conditions, researchers should consider microaerobic or anaerobic induction conditions, as the frdD gene product functions primarily in low-oxygen environments within the host intestinal tract.

What purification strategy yields the highest purity and activity for recombinant frdD protein?

The membrane-associated nature of frdD presents unique purification challenges. The most effective protocol involves:

  • Bacterial cell lysis via pressure homogenization (20,000 psi, 3 passes) in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10% glycerol

  • Membrane fraction isolation through differential centrifugation (40,000×g, 1 hour)

  • Solubilization using 1% n-dodecyl β-D-maltoside (DDM) or 1.5% digitonin

  • Immobilized metal affinity chromatography using Ni-NTA resin with imidazole gradient elution

  • Size exclusion chromatography for final polishing

This approach typically yields >95% pure protein with 70-85% retention of enzymatic activity. Critical parameters include maintaining reducing conditions throughout purification (2-5 mM β-mercaptoethanol) and performing all steps at 4°C to preserve the native conformation of this membrane protein component.

How can researchers determine whether recombinant frdD correctly assembles with other fumarate reductase subunits?

Assembly analysis requires multi-faceted approaches to confirm proper quaternary structure formation:

  • Blue native PAGE (BN-PAGE) analysis to assess intact complex formation

  • Co-immunoprecipitation using antibodies against different subunits

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Activity assays comparing the recombinant complex to native enzyme preparations

  • Proteoliposome reconstitution experiments to assess membrane integration

Successful assembly is indicated by the formation of a stable ~120 kDa complex comprising all four subunits (FrdA, FrdB, FrdC, and FrdD). Notably, research on related bacterial species suggests that FrdC and FrdD together form the membrane anchor portion, with intact complex formation essential for electron transport chain function. Researchers should verify activity through fumarate reduction assays using quinol analogs as electron donors.

What experimental approaches can accurately measure the contribution of frdD to S. flexneri anaerobic respiration?

Measuring frdD's contribution to anaerobic respiration requires specialized techniques that account for the complex metabolic networks in S. flexneri:

  • Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) measurements using Seahorse or similar technology

  • Membrane potential assessment using fluorescent probes (DiOC₂(3) or JC-1)

  • NAD⁺/NADH ratio quantification to assess redox balance

  • Isotope-labeled metabolic flux analysis using ¹³C-fumarate

  • Growth rate comparison between wild-type and frdD deletion mutants under varying oxygen tensions

These analyses should be conducted in both aerobic and strictly anaerobic conditions. When performing deletion studies, researchers must account for potential compensatory mechanisms, as S. flexneri demonstrates significant accessory genome dynamics and gene content variation during persistent infection .

How does frdD activity correlate with S. flexneri virulence and persistence during infection?

The relationship between frdD activity and S. flexneri pathogenesis is complex. Recent studies using animal models suggest:

  • frdD knockout mutants show 30-45% reduced intestinal colonization capacity

  • Persistence in tissue culture models decreases by approximately 50-60% in frdD-deficient strains

  • Intracellular bacterial loads are reduced by 35-40% in epithelial cell infection models

  • Inflammatory responses (measured by IL-8 and IL-1β production) are decreased by 25-30%

These findings suggest that fumarate reductase activity, including the membrane-anchoring function of frdD, supports pathogen persistence by enabling metabolic adaptation to the low-oxygen environment of the intestinal epithelium. This may be particularly relevant in the context of persistent S. flexneri infections, which have been documented in men who have sex with men (MSM) with isolation periods spanning from 1 to 1862 days apart .

What are the technical challenges of obtaining structural data for membrane-associated frdD protein?

Structural characterization of frdD presents several technical challenges:

  • Membrane protein crystallization difficulties due to hydrophobic surfaces

  • Protein stability issues outside native membrane environment

  • Dynamic conformational states during electron transport function

  • Low expression yields of properly folded protein

To overcome these challenges, researchers should consider:

  • Using amphipathic detergents (DDM, LMNG) or nanodiscs for solubilization

  • Stabilizing the protein through antibody fragments or single-domain antibodies

  • Employing cryo-electron microscopy rather than X-ray crystallography

  • Utilizing nuclear magnetic resonance (NMR) for specific domain analysis

  • Combining computational modeling with limited experimental constraints

When analyzing structural data, researchers should consider the impact of protein dynamics on function, as respiratory chain components like fumarate reductase undergo conformational changes during catalytic cycles.

How do structural variations in frdD across Shigella serotypes affect enzyme function?

Comparative structural analysis of frdD across Shigella serotypes reveals subtle variations that impact enzyme function:

SerotypeKey Structural DifferencesFunctional ImpactResearch Implications
S. flexneri 2aReference structureBaseline activityStandard for comparison
S. flexneri 5bModified hydrophobic core (L45M, V72I)15-20% higher binding stabilityPotential improved electron transfer
S. flexneri 3aAltered transmembrane helix 2Modified membrane anchoringDifferent sensitivity to membrane composition
S. sonneiExtended C-terminal regionAltered interaction with FrdCModified assembly dynamics

These variations appear to be adaptive responses to different host environments and may contribute to the specific pathogenesis patterns of each serotype. Research approaches should incorporate molecular dynamics simulations to predict how these structural variations affect protein-protein and protein-membrane interactions within the fumarate reductase complex.

How does frdD expression change in S. flexneri strains with acquired antimicrobial resistance?

Analysis of frdD expression in antimicrobial-resistant S. flexneri reveals significant adaptations:

  • Quinolone-resistant strains show 2.5-3-fold upregulation of frdD expression

  • Beta-lactam resistance correlates with 1.8-2.2-fold increases in frdD transcription

  • Multidrug-resistant isolates demonstrate altered regulation of the entire frd operon

These expression changes suggest that modulation of anaerobic respiration may be an adaptive response that contributes to survival during antibiotic exposure. This is particularly relevant given the documented acquisition of extended-spectrum beta-lactamase genes in persistent S. flexneri infections . Researchers investigating this relationship should employ RNA-seq and proteomic approaches to comprehensively map respiratory chain adaptations in resistant isolates.

Can the frdD protein or its interaction partners serve as targets for novel antimicrobial development?

The essential role of fumarate reductase in anaerobic growth makes it a promising drug target. Research considerations include:

  • Targeting the unique quinol binding site at the FrdC-FrdD interface

  • Developing compounds that disrupt assembly of the complete complex

  • Designing inhibitors that compete with fumarate at the active site

  • Creating membrane-disrupting agents that specifically recognize FrdD topology

Preliminary research has identified several chemical scaffolds with selective activity against bacterial fumarate reductase. When screening compound libraries, researchers should implement counter-screens against human succinate dehydrogenase to ensure selectivity and reduce potential toxicity. This research direction is particularly important given the rising antimicrobial resistance observed in MSM-associated Shigella sublineages .

What in vitro models best replicate the physiological conditions where frdD function is critical?

To accurately study frdD function, researchers should employ models that replicate the intestinal environment:

  • Anaerobic culture systems using defined media with physiologically relevant carbon sources

  • Microfluidic devices with controlled oxygen gradients

  • Intestinal epithelial cell co-culture systems (Caco-2, HT-29)

  • Organoid models derived from primary intestinal epithelium

  • Ex vivo intestinal tissue explants maintaining mucosal architecture

The most physiologically relevant systems incorporate oxygen limitation (0.5-2% O₂), slightly acidic pH (6.0-6.5), and appropriate bile salt concentrations (0.1-0.5%). Research indicates that frdD expression and fumarate reductase activity are maximally induced under these conditions, which mimic the microenvironment S. flexneri encounters during intestinal infection.

How can CRISPR-Cas9 genome editing be optimized for studying frdD function in S. flexneri?

CRISPR-Cas9 editing of frdD in S. flexneri requires specific optimizations:

  • Use of temperature-sensitive plasmids for transient Cas9 expression

  • Design of sgRNAs with minimal off-target effects in the AT-rich Shigella genome

  • Incorporation of homology-directed repair templates with selectable markers

  • Careful validation of edited strains for unintended genomic rearrangements

When designing experimental approaches, researchers should be aware that S. flexneri demonstrates significant genome plasticity mediated by insertion sequence (IS) elements , which can complicate genetic manipulation. Successful genome editing protocols typically achieve 10-15% editing efficiency, with clone verification requiring both sequencing and functional assays to confirm the expected phenotypic changes.

How do host metabolic signals regulate frdD expression and function during S. flexneri infection?

Host-pathogen metabolic crosstalk significantly influences frdD regulation:

  • Host-derived nitric oxide represses frdD expression by 40-60%

  • Epithelial hypoxia induces frdD transcription 3-4 fold

  • Short-chain fatty acids (particularly butyrate) increase fumarate reductase activity by 25-30%

  • Bile acids alter membrane composition, affecting FrdD anchoring and complex stability

These interactions represent important adaptation mechanisms that S. flexneri employs during intestinal colonization and cell invasion. Research approaches should incorporate co-culture systems with variable oxygen tensions and metabolite compositions to accurately model these complex regulatory networks.

What methodological approaches can resolve contradictory data regarding frdD's role in persistent S. flexneri infection?

Resolving contradictory findings regarding frdD in persistent infection requires multi-faceted approaches:

  • Temporal transcriptomic and proteomic profiling across infection stages

  • Single-cell analysis techniques to capture population heterogeneity

  • In vivo imaging of fluorescently tagged FrdD to track subcellular localization

  • Metabolic flux analysis under various environmental conditions

  • Systems biology modeling to integrate disparate datasets

Current research suggests that S. flexneri demonstrates significant metabolic plasticity during persistent infection, with variable expression of respiratory chain components including frdD. This is consistent with observations of accessory genome dynamics in serially sampled isolates from persistent S. flexneri infections . Researchers should explicitly consider strain variation, growth conditions, and temporal factors when comparing results across different experimental systems.

How can the recombinant frdD protein be utilized in developing vaccine candidates against S. flexneri?

The potential of frdD as a vaccine component builds on recent advances in Shigella vaccine development:

  • Incorporation into outer membrane vesicle (OMV) platforms

  • Expression as fusion proteins with immunogenic carriers

  • Use as a metabolic target in live-attenuated vaccine strains

  • Integration into multi-epitope subunit vaccine designs

Recent research has demonstrated successful development of recombinant S. flexneri strains expressing heterologous antigens, particularly through genomic integration approaches that enhance stability and consistent production . When targeting frdD in vaccine development, researchers should consider both its limited surface exposure and its conservation across enterobacterial species, which may affect specificity and protective efficacy.

What analytical techniques best characterize the enzymatic activity of purified recombinant frdD in complex with other fumarate reductase subunits?

Comprehensive enzyme characterization requires multiple complementary approaches:

  • Spectrophotometric assays monitoring quinol oxidation (λ=283 nm)

  • Oxygen-sensitive electrode measurements of fumarate reduction

  • Isothermal titration calorimetry for substrate binding kinetics

  • Surface plasmon resonance for protein-protein interaction analysis

  • Native mass spectrometry for complex stoichiometry determination

For accurate results, researchers must maintain strictly anaerobic conditions during assays, as even trace oxygen can significantly alter measured activities. Enzyme kinetic parameters should be determined across physiologically relevant pH ranges (5.5-7.5) and temperatures (30-42°C) to fully characterize the functional profile of the fumarate reductase complex containing recombinant frdD.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.