Recombinant Shigella flexneri serotype 5b Inner membrane protein CbrB (cbrB)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant CbrB is a full-length, His-tagged protein expressed in Escherichia coli (E. coli) and purified under controlled conditions . It originates from Shigella flexneri serotype 5b, a pathogenic strain responsible for severe diarrheal diseases. Key production details include:

ParameterSpecification
Host SystemE. coli
Expression RegionAmino acids 1–157 (full-length)
TagPolyhistidine (His) tag
Purity>85% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose

This recombinant protein is primarily used for antibody development, functional assays, and structural studies .

Research Applications

Recombinant CbrB serves as a tool for:

  • Antibody Development: Generating antisera for diagnostic or therapeutic purposes.

  • Vaccine Design: Exploring cross-reactive epitopes, analogous to O-antigen conjugate vaccines (e.g., IpaB in Shigella) .

  • Mechanistic Studies: Investigating membrane protein interactions in bacterial pathogenesis .

Comparative Analysis with Related Proteins

CbrB shares functional parallels with other Shigella membrane proteins:

ProteinFunctionRole in Pathogenesis
CbrBMembrane stability, putative transporterHypothesized to aid in host-cell persistence
IpgB1Activates Rho GTPasesPromotes DMV escape and cell-to-cell spread
YfiBModulates cyclic-di-GMP levelsRegulates biofilm formation and invasion

Unlike O-antigens (e.g., serotype 2a/3a), CbrB is not a primary vaccine target but may act as an adjuvant or secondary antigen .

Future Directions

Current knowledge gaps include:

  • Elucidating CbrB’s precise biochemical role via knockout studies.

  • Assessing immunogenicity in animal models.

  • Exploring synergies with other virulence factors (e.g., IcsA, Ipa proteins) .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cbrB; SFV_3795; Inner membrane protein CbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
cbrB
Target Protein Sequence
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIP ALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGD SLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS
Uniprot No.

Target Background

Database Links

KEGG: sfv:SFV_3795

Protein Families
CbrB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the distinguishing characteristics of Shigella flexneri serotype 5b compared to other serotypes?

Shigella flexneri serotype 5b is distinguished by its unique O-antigen structure and modification patterns. Similar to other serotypes, it possesses specific O-antigen modification genetic markers such as glucosyltransferases, which contribute to serotype specificity. The serotyping of Shigella flexneri is primarily based on the lipopolysaccharide (LPS) O-antigen structure, which can be identified through techniques such as in silico serotype prediction. Tools like ShigaTyper can detect the presence of genetic markers for O-antigen flippase (Sf_wzx) and polymerase (Sf_wzy), along with specific O-antigen modification genes . Understanding these serotype-specific characteristics is crucial for vaccine development and epidemiological studies, as different serotypes may exhibit varying patterns of geographical distribution and antimicrobial resistance profiles.

How do inner membrane proteins contribute to Shigella flexneri virulence and pathogenesis?

Inner membrane proteins in Shigella flexneri play critical roles in multiple aspects of bacterial virulence and pathogenesis. They are involved in various functions including signal transduction, nutrient transport, cell envelope maintenance, and coordination of virulence factor expression. For example, inner membrane proteins can be part of signaling systems that regulate cyclic-di-GMP levels, which impact biofilm formation, cytotoxicity, motility, and other virulence mechanisms like adhesion and invasion . Some membrane proteins participate in secretion systems, particularly the Type III Secretion System (T3SS), which is essential for the translocation of effector proteins into host cells. The virulence of Shigella flexneri depends heavily on its invasive capabilities, which require the coordinated action of numerous membrane-associated proteins, including those encoded by the ipa gene family . These proteins facilitate bacterial entry into epithelial cells and subsequent intercellular spread.

What methods are most effective for predicting membrane protein topology in Shigella flexneri?

Predicting membrane protein topology in Shigella flexneri involves a multi-faceted approach combining computational and experimental methods. Computationally, hydropathy analysis tools such as TMHMM, Phobius, and TOPCONS are commonly used to identify transmembrane domains based on hydrophobicity patterns. For more accurate predictions, homology modeling can be employed when structural data from homologous proteins are available, as was done in comparative studies between YfiB proteins from Shigella and Pseudomonas . Experimentally, topology can be verified through fusion reporter assays using PhoA (alkaline phosphatase) or GFP fusions, which provide information about the cytoplasmic or periplasmic orientation of protein domains. Site-directed mutagenesis of key amino acid residues, followed by functional assays, can also provide insights into topology-function relationships, as demonstrated in studies of the YfiBNR system in Shigella flexneri . For high-resolution structural determination, techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would be required, though these are technically challenging for membrane proteins.

What expression systems are most suitable for producing recombinant membrane proteins from Shigella flexneri serotype 5b?

For recombinant membrane protein expression from Shigella flexneri serotype 5b, several expression systems can be employed depending on research objectives. For structural and functional studies, Escherichia coli-based expression systems are often preferred due to their genetic similarity to Shigella and established protocols. These systems typically utilize vectors with tunable promoters (such as T7, tac, or arabinose-inducible promoters) and fusion tags (His, GST, or MBP) to facilitate purification . For vaccine development applications, stable chromosomal integration approaches may be more suitable than plasmid-based systems. This approach was successfully implemented in a study developing a recombinant Shigella flexneri strain expressing ETEC heat-labile enterotoxin B (LTB), where the eltb gene was incorporated directly into Shigella's genome to enhance stability and consistent production . For membrane proteins with complex folding requirements, specialized E. coli strains (C41, C43) or eukaryotic systems like yeast (Pichia pastoris) might be necessary. When expressing potentially toxic membrane proteins, the use of tightly regulated inducible systems with careful optimization of induction parameters (temperature, inducer concentration, and timing) is critical to balance protein expression with cellular toxicity.

How can I optimize the solubilization and purification of Shigella flexneri inner membrane proteins while maintaining their native conformation?

Optimizing solubilization and purification of Shigella flexneri inner membrane proteins requires careful consideration of detergent selection and purification conditions. For initial extraction, a systematic screening of detergents is recommended, starting with mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or LMNG, which often preserve protein conformation. The critical micelle concentration (CMC) of the chosen detergent must be maintained throughout purification to prevent protein aggregation. A multi-step purification approach is typically necessary, beginning with affinity chromatography (if a fusion tag is present), followed by size exclusion chromatography to remove aggregates and achieve higher purity. Throughout purification, buffer conditions should be optimized for pH, ionic strength, and glycerol content to enhance stability. For particularly challenging proteins, amphipathic polymers (amphipols), nanodiscs, or styrene maleic acid lipid particles (SMALPs) may provide alternatives to traditional detergent methods, as they better mimic the native lipid environment. Quality control of purified proteins should include functional assays, circular dichroism spectroscopy, and thermal stability assays to verify that the native conformation has been maintained. For proteins involved in signaling pathways like the YfiBNR system, activity assays measuring cyclic-di-GMP levels can confirm functional integrity of the purified protein .

What techniques are available for assessing the structural integrity of recombinant Shigella flexneri membrane proteins?

Multiple complementary techniques can be employed to assess the structural integrity of recombinant Shigella flexneri membrane proteins. Circular dichroism (CD) spectroscopy provides information about secondary structure content (α-helices, β-sheets) and can be used to monitor structural changes under different conditions. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) helps determine the oligomeric state and homogeneity of the purified protein. Thermal shift assays, such as differential scanning fluorimetry (DSF), provide insights into protein stability and can help identify stabilizing buffer conditions or ligands. For more detailed structural information, limited proteolysis followed by mass spectrometry can identify flexible regions and stable domains. Advanced structural techniques include single-particle cryo-electron microscopy, which has become increasingly accessible for membrane protein structure determination with recent technological advances. Nuclear magnetic resonance (NMR) spectroscopy can provide information about protein dynamics and ligand interactions for smaller membrane proteins or specific domains. X-ray crystallography remains challenging for membrane proteins but can provide high-resolution structures when successful. For functional validation, activity assays specific to the protein's biological role should be developed – for example, in studies of the YfiBNR system in Shigella, researchers assessed the impact on biofilm formation, bacterial invasion, and host-surface attachment to confirm functional integrity .

What mechanisms govern the incorporation of heterologous proteins into the outer membrane vesicles (OMVs) of recombinant Shigella flexneri strains?

The incorporation of heterologous proteins into outer membrane vesicles (OMVs) of recombinant Shigella flexneri involves several molecular mechanisms that can be strategically utilized in vaccine development. OMVs are naturally released vesicles that contain outer membrane proteins, periplasmic components, and various virulence factors. For heterologous protein incorporation, several targeting approaches can be employed. Direct genomic integration of the heterologous gene, as demonstrated with the eltb gene encoding ETEC's heat-labile enterotoxin B (LTB) subunit, provides stable expression and incorporation into OMVs . The localization of the expressed protein is critical – proteins naturally targeted to the periplasm or outer membrane are more efficiently incorporated into OMVs. This can be achieved through fusion with signal peptides or membrane anchoring domains. In the case of LTB expression in Shigella flexneri, successful incorporation into OMVs was confirmed through GM1-capture ELISA and proteomic analysis, which verified that the isolated vesicles contained both the LTB protein and the main outer membrane proteins and virulence factors from Shigella . The stability and immunogenicity of heterologous antigens in OMVs depend on proper folding and preservation of epitopes, which can be influenced by the local microenvironment within the vesicle. Understanding these mechanisms allows for rational design of recombinant Shigella strains that produce OMVs carrying specific antigens of interest, creating promising platforms for subunit vaccine development against multiple pathogens.

How can we elucidate the interactome of Shigella flexneri membrane proteins and identify novel protein-protein interactions involved in virulence?

Elucidating the interactome of Shigella flexneri membrane proteins requires a multi-faceted approach combining genetic, biochemical, and computational methods. Co-immunoprecipitation coupled with mass spectrometry provides a powerful technique for identifying protein-protein interactions in their native context. This approach can be enhanced by using cross-linking agents that stabilize transient interactions before cell disruption. For membrane proteins specifically, approaches like membrane yeast two-hybrid (MYTH) or split-ubiquitin systems offer advantages over traditional yeast two-hybrid assays, as they are designed to work with membrane-associated proteins. Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling can capture both stable and transient interactions within the cellular environment. For detailed characterization of specific interactions, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities and kinetics. Genetic approaches such as suppressor screens or synthetic lethality assays can identify functional relationships between proteins. The YfiBNR system in Shigella flexneri provides an example where targeted mutagenesis of specific amino acids helped establish which residues are essential for protein-protein interactions within this signaling complex . Computational approaches, including homology-based prediction and co-evolution analysis, can guide experimental design by predicting potential interaction partners. Integrating data from multiple approaches into a network analysis can reveal functional modules and key hubs in the membrane protein interactome, potentially identifying novel targets for therapeutic intervention.

What strategies can overcome the challenges posed by increasing antimicrobial resistance in Shigella flexneri?

Addressing increasing antimicrobial resistance in Shigella flexneri requires a multi-faceted approach combining traditional and innovative strategies. Surveillance and monitoring form the foundation of effective resistance management, as demonstrated by the successful detection of clonal multidrug-resistant (MDR) S. flexneri through sentinel sequence-based surveillance . This approach enables early detection of emerging resistant clones and informs public health interventions. Alternative antimicrobial approaches include the development of novel compounds with mechanisms distinct from traditional antibiotics. While research has identified potential candidates like oral carbapenems, concerns remain about promoting resistance to last-line antimicrobials . Combination therapy using multiple antimicrobial agents with different mechanisms of action can reduce the likelihood of resistance development. Targeting bacterial virulence rather than growth offers another promising approach, with the YfiBNR signaling system and cyclic-di-GMP regulation presenting potential targets for anti-virulence compounds . Vaccine development represents a critical preventive strategy, with several approaches in development including live-attenuated, glycoconjugate, outer membrane vesicles, and protein subunit designs . Particularly promising are recombinant approaches that incorporate antigens from multiple pathogens, such as the Shigella flexneri strain expressing ETEC's heat-labile enterotoxin B (LTB) . Monoclonal antibodies (mAbs) show potential as both prophylactic and therapeutic agents against Shigella infections . Long-term control will likely require comprehensive approaches combining improved antimicrobials, vaccines, mAbs, and enhanced public health measures to address the complex challenge of antimicrobial resistance in Shigella.

What are the key considerations in designing and evaluating recombinant outer membrane vesicle (OMV) vaccines against Shigella flexneri?

Designing and evaluating recombinant outer membrane vesicle (OMV) vaccines against Shigella flexneri involves several critical considerations. For antigen selection and engineering, researchers must identify conserved antigens across relevant serotypes to ensure broad protection. The successful incorporation of ETEC's heat-labile enterotoxin B (LTB) into S. flexneri OMVs demonstrates the feasibility of creating chimeric vaccines targeting multiple pathogens . Protein expression levels and localization significantly impact vaccine efficacy, with stable genomic integration providing consistent antigen production compared to plasmid-based systems . OMV isolation and purification methods must balance yield with vesicle integrity and antigen preservation. Techniques like density gradient ultracentrifugation, tangential flow filtration, or precipitation methods can be optimized for specific applications. Quality control measures should include proteomic analysis to verify the presence of target antigens and native virulence factors, as was performed to confirm LTB incorporation alongside native S. flexneri proteins like OmpA, OmpC, and various virulence factors . Immunological evaluation is essential, with in vitro assays assessing antigen-specific antibody responses, neutralization capacity, and cellular immunity. Animal models provide insights into protective efficacy, though these results may not fully translate to humans. Human challenge models are being developed to accelerate vaccine clinical development . Safety considerations include endotoxin content, residual bacterial components, and potential reactogenicity. Formulation aspects, including adjuvant selection, dosing regimen, and storage stability, must be optimized for maximal efficacy and practicality in target populations. Through systematic evaluation of these parameters, researchers can develop effective OMV-based vaccines against the increasing threat of antimicrobial-resistant Shigella.

How can genome-wide association studies (GWAS) and comparative genomics inform the development of subunit vaccines against different Shigella flexneri serotypes?

Genome-wide association studies (GWAS) and comparative genomics provide powerful tools for informing Shigella flexneri subunit vaccine development. These approaches can identify conserved antigens across serotypes by analyzing large genomic datasets, such as the 11,134 publicly available S. flexneri genomes examined in surveillance studies . Through pangenome analysis, researchers can differentiate core genes (present in all strains) from accessory genes, prioritizing conserved antigens as vaccine candidates. Comparative genomics enables identification of serotype-specific genetic markers, such as the O-antigen modification genes like glucosyltransferases gtrI and gtrIC found in serotype 1c . Understanding these markers is crucial for designing vaccines with broad serotype coverage. Virulence factor conservation analysis reveals that certain proteins, such as those in the invasive plasmid antigen (ipa) family, are consistently present across Shigella isolates, making them attractive vaccine targets . Phylogenetic analysis informs vaccine design by revealing evolutionary relationships between strains and predicting which antigenic variants should be included for comprehensive protection. For example, core genome SNP analysis has revealed clonal relationships among emerging multidrug-resistant strains . Analysis of membrane protein conservation specifically can identify outer membrane proteins that are both surface-exposed and antigenically conserved, ideal characteristics for subunit vaccine candidates. Population structure studies inform geographical targeting of vaccines by identifying prevalent clones in specific regions. Epitope mapping through computational prediction and experimental validation helps identify immunodominant regions within antigens that can be incorporated into subunit vaccines. Finally, monitoring antigenic drift through ongoing genomic surveillance enables vaccine reformulation if necessary, ensuring continued efficacy against evolving Shigella populations. This data-driven approach to vaccine development promises more targeted and effective interventions against shigellosis.

What are the emerging technologies that could revolutionize membrane protein research in Shigella flexneri?

Several emerging technologies are poised to revolutionize membrane protein research in Shigella flexneri. Cryo-electron microscopy (cryo-EM) has undergone remarkable advances, now enabling near-atomic resolution of membrane proteins without crystallization, addressing a major historical challenge in structural biology. This approach could provide unprecedented insights into the structure of complexes like the YfiBNR signaling system . CRISPR-Cas9 genome editing techniques allow for precise manipulation of Shigella genomes, facilitating rapid generation of knockout or knock-in mutants for functional studies of membrane proteins. This approach improves upon traditional methods like lambda red recombination used in previous studies . Nanobody technology, using single-domain antibody fragments, offers new tools for membrane protein stabilization, crystallization, and functional modulation. Nanobodies can lock proteins in specific conformational states, enabling structural studies of otherwise dynamic membrane proteins. Native mass spectrometry methods preserve membrane protein-lipid interactions during analysis, providing insights into how the lipid environment influences protein structure and function. Artificial intelligence approaches, particularly AlphaFold2 and RoseTTAFold, can predict membrane protein structures with unprecedented accuracy, potentially accelerating research by providing structural models even before experimental determination. Microfluidic platforms enable high-throughput screening of conditions for membrane protein expression, solubilization, and crystallization, addressing the bottleneck of optimizing conditions for individual proteins. Lipid nanodisc technologies provide more native-like membrane environments for functional and structural studies, potentially revealing aspects of protein behavior obscured in detergent micelles. Integration of these technologies could significantly accelerate our understanding of membrane proteins in Shigella flexneri, leading to novel therapeutic approaches for this important pathogen.

How might systems biology approaches advance our understanding of membrane protein networks in Shigella pathogenesis?

Systems biology approaches offer powerful frameworks for understanding the complex role of membrane protein networks in Shigella pathogenesis. Multi-omics integration combines genomics, transcriptomics, proteomics, and metabolomics data to provide a comprehensive view of how membrane proteins function within broader cellular networks. For example, integrating proteomic analysis of outer membrane vesicles with transcriptomic data under different conditions could reveal coordinated expression patterns of virulence factors . Network biology approaches identify functional modules and key regulatory hubs within membrane protein interaction networks. Applied to Shigella, this could reveal how signaling systems like YfiBNR connect to broader virulence networks . Quantitative modeling of signaling pathways, such as the cyclic-di-GMP pathway regulated by membrane proteins, can predict system behavior under different conditions and generate testable hypotheses about intervention points. Host-pathogen interaction modeling examines how Shigella membrane proteins interact with host cell receptors and immune components, potentially identifying critical interfaces for therapeutic targeting. Single-cell approaches reveal heterogeneity in bacterial populations, potentially explaining phenomena like persister cell formation in response to antibiotics. Comparative systems analyses across different Shigella serotypes and closely related species could highlight conserved and divergent aspects of membrane protein function. Synthetic biology approaches allow for the construction of minimal or modified membrane protein systems to test hypotheses about network function and potentially engineer strains with desirable properties, such as improved vaccine candidates . Evolutionary systems biology examines how membrane protein networks have evolved in response to selective pressures, potentially identifying adaptations to different host environments or antimicrobial challenges. Together, these systems approaches promise to transform our understanding of how membrane proteins contribute to Shigella pathogenesis from a collection of individual components to an integrated network perspective.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.