Recombinant Shigella flexneri serotype 5b NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Key Features of Recombinant nuoA

ParameterSpecificationSource(s)
Species/SerotypeShigella flexneri serotype 5b (strain 8401)
Uniprot IDQ0T2J9
Gene LocusSFV_2355
AA SequenceMSMSTSTEVIAHHWAFAIFLIVAIGLCCLmLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Length147 amino acids (partial sequence)
Enzyme ClassificationEC 1.6.99.5 (NADH-quinone oxidoreductase)

Notes:

  • The recombinant protein is expressed in bacterial systems (e.g., E. coli, yeast, or mammalian cells) .

  • The tag type (e.g., His-tag) is determined during production and is not explicitly specified in available data .

Biochemical Function

nuoA is part of the NDH-1 complex, a multi-subunit enzyme responsible for:

  1. Electron Transport: Transferring electrons from NADH to quinones in the bacterial respiratory chain .

  2. Proton Translocation: Contributing to the proton gradient required for ATP synthesis .

Key Observations:

  • The NDH-1 complex is conserved across Gram-negative bacteria, including Shigella species.

  • While nuoA is essential for energy metabolism, its direct role in S. flexneri virulence remains uncharacterized in published studies.

Primary Uses

  1. ELISA Kits:

    • The recombinant nuoA is marketed as a component of ELISA kits for detecting antibodies against S. flexneri 5b in serum or mucosal samples .

    • Target Audience: Researchers investigating Shigella serotype-specific immune responses.

  2. Structural Studies:

    • Used to study interactions between NADH-quinone oxidoreductase subunits or inhibitors .

Limitations

  • No peer-reviewed studies explicitly validate nuoA’s diagnostic utility or therapeutic potential.

  • Limited data on cross-reactivity with other Shigella serotypes (e.g., 2a, 6) .

Comparative Analysis with Other Shigella Serotypes

FeatureS. flexneri 5b (nuoA)S. flexneri 2a/6 (Other Proteins)Source(s)
O-Antigen StructureNot directly linked to nuoACritical for serotype distinction
Vaccine TargetsNot reportedLPS O-chain (e.g., SCV-Sf6)
Immune EvasionUnstudiedSerotype conversion via phage genes

Key Insight:

  • While nuoA is specific to S. flexneri 5b, most vaccine development focuses on O-antigen components (e.g., S. flexneri 2a, 6) due to their role in immune evasion and pathogenicity .

Research Gaps and Future Directions

  1. Functional Studies:

    • Investigate whether nuoA modulates S. flexneri’s intracellular survival or colonization.

  2. Diagnostic Validation:

    • Assess sensitivity/specificity of nuoA-based ELISA in clinical samples.

  3. Therapeutic Potential:

    • Explore inhibitors targeting nuoA as antimicrobial agents.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; SFV_2355; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links

KEGG: sfv:SFV_2355

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying recombinant Shigella flexneri serotype 5b nuoA?

Recombinant Shigella flexneri serotype 5b NADH-quinone oxidoreductase subunit A (nuoA) represents an important target for understanding bacterial metabolism and pathogenicity. Shigella flexneri causes bacillary dysentery, a potentially life-threatening illness particularly affecting children in underdeveloped regions, with serotype 5b being a significant contributor to global disease burden . The study of nuoA is particularly valuable because electron transport chain components like NADH-quinone oxidoreductase are essential for bacterial survival and may represent targets for intervention.

NuoA's importance is further contextualized by gene essentiality studies comparing S. flexneri with E. coli, which have identified metabolic proteins that are differentially essential between these closely related organisms . While studies have found only a small number of genes essential for Shigella growth yet dispensable in E. coli, such differences may highlight adaptation to pathogenic lifestyles and represent potential targets for serotype-specific interventions .

Methodologically, studying recombinant nuoA requires:

  • Genomic sequence analysis to identify serotype-specific variations

  • Comparative analysis with homologous proteins in related bacteria

  • Assessment of essentiality in the context of bacterial metabolism

  • Evaluation of conservation across Shigella strains

How does the genetic context of nuoA in Shigella flexneri serotype 5b influence experimental approaches?

The genetic context of nuoA in Shigella flexneri serotype 5b presents unique considerations for experimental design. Complete genome sequencing of S. flexneri 5b has revealed dynamic and diverse genomic features compared to other serotypes, with specific chromosomal rearrangements and pathogenicity islands that may influence gene expression and protein function . These genomic differences must be accounted for when designing experiments involving nuoA.

When designing experiments with nuoA, researchers must consider:

  • Operon structure: NuoA is part of the nuo operon encoding the multisubunit NADH-quinone oxidoreductase complex

  • Regulatory elements: Promoter regions may differ between serotypes

  • Genomic stability: IS elements in Shigella genomes may affect expression of nearby genes

  • Selective pressures: Different serotypes have undergone different evolutionary processes

A methodological approach requires:

  • Analysis of upstream regulatory regions specific to serotype 5b

  • Consideration of co-expressed genes that may affect nuoA function

  • Evaluation of potential polar effects when manipulating the gene

Table 1: Comparative Genomic Context Analysis for nuoA Experiments

ConsiderationSerotype 5b Specific ApproachGeneral Approach
Promoter analysisAccount for serotype 5b-specific regulatory elementsUse conserved promoter sequences
Operon structureConsider serotype 5b-specific nuo operon organizationAssume conservation with E. coli
Genetic stabilityEvaluate presence of nearby IS elements in serotype 5bTarget conserved regions
Codon optimizationUse serotype 5b-specific codon usageUse generalized enterobacterial codon usage

What biochemical characteristics of Shigella flexneri serotype 5b should inform recombinant nuoA studies?

Understanding the biochemical characteristics of Shigella flexneri serotype 5b is crucial for successful recombinant nuoA studies. S. flexneri serotype 5b exhibits specific biochemical traits that could influence protein expression, purification, and functional analyses . These characteristics provide the foundation for designing appropriate experimental conditions.

Key biochemical traits of S. flexneri that impact recombinant protein studies include:

  • Metabolism: S. flexneri is positive for mannitol, mannose, and trehalose utilization, but negative for lactose and sucrose utilization

  • Enzymatic profile: Catalase positive but oxidase negative

  • Redox properties: Positive for methyl red test, indicating acid production under fermentative conditions

  • Adaptation mechanisms: Limited carbon source utilization compared to E. coli, reflecting adaptation to host environment

Methodological implications include:

For expression optimization:

  • Use growth media containing metabolizable carbon sources (mannose, trehalose)

  • Consider aeration needs for optimal expression

  • Account for acid production during fermentative growth

For functional studies:

  • Design assays that account for the native biochemical environment of nuoA

  • Include appropriate controls reflecting the redox state in S. flexneri

  • Consider the impact of S. flexneri-specific metabolic pathways on nuoA function

These biochemical characteristics inform experimental design from expression to functional characterization, ensuring physiologically relevant conditions for studying recombinant nuoA.

What expression systems are most effective for producing recombinant Shigella flexneri nuoA?

The selection of an appropriate expression system is critical for successful production of recombinant Shigella flexneri nuoA. As a membrane-associated protein involved in electron transport, nuoA presents specific challenges for recombinant expression. Based on successful approaches with other Shigella proteins, several expression systems warrant consideration.

Escherichia coli expression systems have been successfully employed for multiple Shigella proteins. For example, IpaB and IpaC were efficiently expressed in E. coli after optimization of host cell lines, growth conditions, and expression vectors . For membrane proteins like nuoA, specialized E. coli strains (C41(DE3) or C43(DE3)) designed for membrane protein expression may yield better results.

Methodological considerations for nuoA expression include:

  • Expression vector selection:

    • pET system with T7 promoter for high-level expression

    • pBAD system for tunable expression with arabinose induction

    • Fusion tags to aid solubility (MBP, SUMO, TrxA)

  • Host strain selection:

    • BL21(DE3) derivatives for general expression

    • C41/C43(DE3) for membrane proteins

    • Rosetta strains to address codon bias issues

  • Induction conditions optimization:

    • Lower temperatures (16-25°C) to slow expression and aid folding

    • Reduced inducer concentrations

    • Extended induction times

Table 2: Expression System Comparison for Recombinant Shigella Proteins

Expression SystemAdvantagesDisadvantagesSuitable for nuoA
E. coli (pET)High yield, simple protocolsInclusion body formation commonWith optimization
E. coli (C41/C43)Better for membrane proteinsLower yields than standard strainsHighly recommended
Yeast systemsBetter for eukaryotic foldingMore complex protocolsPossibly for functional studies
BaculovirusExcellent for complex proteinsTime-consuming, expensiveFor structural studies

For optimal results, a methodical approach testing multiple expression systems with varying conditions is recommended, starting with E. coli C41/C43 strains with reduced induction temperature .

What purification strategies yield the highest purity and activity for recombinant nuoA?

Purification of recombinant Shigella flexneri nuoA presents significant challenges due to its membrane-associated nature. Drawing from successful purification strategies for other Shigella proteins, a multi-step approach combining affinity chromatography with additional purification steps is recommended.

The purification strategy should address:

  • Membrane extraction: Efficient solubilization of nuoA from membranes

  • Protein stability: Maintaining native conformation throughout purification

  • Purity requirements: Achieving >85% purity for functional studies

  • Activity preservation: Retaining enzymatic activity

A methodological approach based on successful purification of other Shigella proteins includes:

Step 1: Membrane extraction

  • Use mild detergents (DDM, LMNG, or Triton X-100) for membrane solubilization

  • Optimize detergent concentration to minimize denaturation

  • Include protease inhibitors to prevent degradation

Step 2: Initial capture

  • Immobilized metal affinity chromatography (IMAC) with His-tagged nuoA

  • Carefully optimize imidazole concentrations in wash and elution buffers

  • Incorporate detergent in all buffers to maintain solubility

Step 3: Secondary purification

  • Size exclusion chromatography to separate aggregates

  • Ion exchange chromatography for charge-based separation

  • Add stabilizing agents like glycerol (5-50%) for long-term storage

Step 4: Quality assessment

  • SDS-PAGE to confirm purity (target >85%)

  • Western blotting for identity confirmation

  • Activity assays to confirm functional integrity

When designing the purification protocol, it's critical to maintain a consistent detergent concentration throughout all steps to prevent protein aggregation. For storage, recombinant membrane proteins like nuoA typically require glycerol addition (final concentration 5-50%) and storage at -20°C/-80°C, with a typical shelf life of 6 months in liquid form .

How can researchers troubleshoot low expression or poor solubility of recombinant nuoA?

Troubleshooting low expression or poor solubility of recombinant Shigella flexneri nuoA requires a systematic approach addressing multiple parameters. Membrane proteins like nuoA are notoriously challenging to express in soluble, functional form. Drawing from approaches used for other difficult-to-express Shigella proteins, several methodological strategies can be implemented.

Key troubleshooting approaches include:

Expression optimization:

  • Codon optimization for the expression host

  • Testing different fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Varying promoter strength to modulate expression rates

  • Modifying the construct to exclude problematic regions

A variety of approaches can be employed including "different host cell lines, modification of bacterial growth conditions, and the use of alternative plasmid expression vectors" . For membrane proteins specifically:

Solubility enhancement:

  • Co-expression with chaperones (GroEL/ES, DnaK/J)

  • Expression as truncated functional domains

  • Screening detergent panels for optimal solubilization

  • Using specialized E. coli strains (e.g., Lemo21(DE3) for tunable expression)

Optimization matrix:

  • Test multiple temperatures: 16°C, 25°C, 30°C, 37°C

  • Vary inducer concentrations: 0.1 mM, 0.5 mM, 1.0 mM IPTG or equivalent

  • Adjust induction timing: early log, mid-log, late log phase

  • Modify media composition: rich vs. minimal, supplemented with cofactors

Table 3: Troubleshooting Matrix for Recombinant nuoA Expression

ParameterVariationExpected OutcomeSuccess Indicators
TemperatureLower (16-25°C)Slower expression, better foldingIncreased soluble fraction
Inducer concentrationReduced (0.1-0.2 mM IPTG)Controlled expression rateLess inclusion body formation
Media compositionTerrific Broth + 1% glucoseBetter biomass, reduced basal expressionHigher cell density, better yield
Fusion partnerMBP, SUMO, TrxEnhanced solubilityDetectable soluble protein
DetergentDDM, LMNG, Triton X-100Effective membrane extractionProtein in supernatant after centrifugation

A systematic approach documenting each condition tested and its outcome will facilitate identification of optimal conditions. For particularly recalcitrant proteins, alternative expression systems such as cell-free expression may be considered .

How should experiments be designed to study enzymatic activity of recombinant nuoA?

Designing experiments to study the enzymatic activity of recombinant Shigella flexneri nuoA requires careful consideration of its native function within the NADH-quinone oxidoreductase complex. As a membrane-bound respiratory chain component, nuoA's activity must be assessed in a context that preserves its native environment or reconstitutes critical interactions.

A comprehensive experimental design approach includes:

Step 1: Experimental Planning Table
Begin with a clearly defined experimental design table outlining:

  • Hypothesis or specific question about nuoA activity

  • Independent variables (e.g., substrate concentrations, pH, inhibitors)

  • Dependent variables (e.g., rate of electron transfer, oxygen consumption)

  • Control groups and controlled variables

  • Number of replicates needed for statistical validity

Step 2: Activity Assay Selection
For NADH-quinone oxidoreductase activity:

  • Spectrophotometric assays tracking NADH oxidation (decrease in absorbance at 340 nm)

  • Oxygen consumption measurements using oxygen electrodes

  • Artificial electron acceptor assays (e.g., with ferricyanide)

  • Reconstituted proteoliposome assays for membrane-embedded function

Step 3: Control Development
Essential controls include:

  • Enzymatically inactive nuoA (site-directed mutant) as negative control

  • Purified E. coli homolog for comparison

  • Substrate-free reactions to establish baseline

  • Heat-denatured enzyme controls

Step 4: Data Collection Design
Create appropriate data tables for recording experimental measurements:

  • First column for independent variable values

  • Subsequent columns for replicates of dependent variable measurements

  • Final column for calculated mean values

Step 5: Validation Approach
Validate activity findings through complementary methods:

  • Correlation of activity with protein concentration

  • Inhibition profiles with known inhibitors

  • pH and temperature optima determination

  • Kinetic parameter calculations (Km, Vmax)

For technically challenging membrane proteins like nuoA, multiple approaches may be necessary, potentially including whole-cell assays and membrane fraction assays alongside purified protein studies.

What controls are essential when evaluating interactions between nuoA and other complex components?

Evaluating interactions between recombinant nuoA and other components of the NADH-quinone oxidoreductase complex requires rigorous controls to ensure specific and physiologically relevant results. Given that nuoA functions as part of a multi-subunit complex, interaction studies must discriminate between specific and non-specific associations.

Essential controls for interaction studies include:

  • Negative interaction controls

    • Unrelated membrane protein with similar physicochemical properties

    • Denatured nuoA to detect non-specific hydrophobic interactions

    • Empty vector/tag-only controls to identify tag-mediated interactions

  • Positive interaction controls

    • Known interacting partners from the same complex (e.g., nuoH, nuoJ)

    • E. coli homolog interaction pairs to benchmark methodology

    • Reconstituted partial complexes with established interaction patterns

  • Experimental condition controls

    • Detergent type and concentration variations to identify detergent-sensitive interactions

    • Salt concentration gradient tests to distinguish electrostatic interactions

    • pH variations to identify charge-dependent associations

For pull-down assays specifically:

  • Competitive inhibition controls with excess untagged protein

  • Graduated concentration series to establish binding saturation

  • Cross-linking distance controls to validate spatial proximities

Table 4: Controls for nuoA Interaction Studies

Control TypeSpecific ControlWhat It ValidatesInterpretation Guide
NegativeUnrelated membrane proteinSpecificity of interactionShould show minimal binding
NegativeTag-only constructTag influence on bindingSignal should be substantially lower than with full protein
PositiveKnown complex componentAssay functionalityShould show clear interaction
ConditionalIncreasing salt (50-500mM)Electrostatic contributionDecreasing signal indicates electrostatic component
ConditionalDetergent panelHydrophobic environment requirementsOptimal detergent preserves specific interactions

How can researchers investigate the role of nuoA in Shigella virulence and pathogenicity?

Investigating the role of NADH-quinone oxidoreductase subunit A (nuoA) in Shigella flexneri virulence requires methodological approaches that connect metabolic function to pathogenic processes. As electron transport chain components are not traditional virulence factors, establishing their contribution to pathogenesis demands carefully designed experimental approaches.

Methodological framework:

  • Gene Essentiality Assessment

    • Compare essentiality of nuoA in Shigella vs. E. coli using Tn-seq data

    • Determine if nuoA is differentially essential under host-relevant conditions

    • Assess whether nuoA falls within the category of genes that are "important for growth in Shigella flexneri, yet not in Escherichia coli"

  • Conditional Knockdown Experiments

    • Develop inducible knockdown strains to titrate nuoA expression

    • Assess impact on growth in media mimicking host conditions

    • Evaluate changes in expression of known virulence factors

  • Host Cell Interaction Models

    • Compare wild-type and nuoA-depleted strains in epithelial cell invasion assays

    • Assess intracellular survival and replication with manipulated nuoA levels

    • Evaluate respiratory capacity during different stages of infection

  • Metabolic Contribution Analysis

    • Characterize metabolic shifts under nuoA limitation

    • Correlate respiratory capacity with expression of virulence genes

    • Map metabolic adaptations to pathogenicity island activation

  • In vivo Significance Testing

    • Develop nuoA mutants with altered function but retained viability

    • Assess competitive indices in animal models of infection

    • Evaluate tissue distribution and persistence with modified nuoA

Table 5: Experimental Approaches Linking nuoA to Virulence

ApproachMethodologyExpected OutcomeInterpretation
Metabolic profilingMetabolomics during infectionAltered metabolite profilesIdentifies nuoA-dependent metabolic shifts during infection
Virulence gene expressionRT-qPCR of virulence factors with nuoA modulationChanged expression patternsLinks respiratory status to virulence regulation
Host cell energeticsMeasurement of ATP levels in infected cellsEnergy state changesConnects bacterial respiration to host energy disruption
Stress response activationReporter strains monitoring stress response with nuoA modulationAltered stress responsesIdentifies how respiratory deficits trigger pathogenic adaptations

The experimental approach should systematically connect nuoA function to virulence, recognizing that "metabolic processes" may contribute significantly to Shigella's adaptation to the host environment and its pathogenic lifestyle .

How can recombinant nuoA contribute to Shigella vaccine development strategies?

Recombinant nuoA from Shigella flexneri serotype 5b may contribute to novel vaccine development strategies through several mechanisms. While traditional Shigella vaccine approaches have focused on outer membrane proteins and virulence factors, metabolic proteins like nuoA offer complementary advantages for comprehensive vaccine design.

Methodological approaches for nuoA in vaccine development:

  • Antigen Discovery and Validation

    • Apply reverse vaccinology principles to evaluate nuoA's potential as a vaccine antigen

    • Analyze sequence conservation across Shigella strains to assess broad protection potential

    • Predict B and T cell epitopes using immunoinformatics tools, similar to approaches used for TolC evaluation

  • Recombinant Protein Production for Immunization

    • Express nuoA or immunogenic fragments with optimized solubility

    • Ensure proper folding of antigenic epitopes

    • Achieve high purity (>85%) suitable for immunization studies

  • Outer Membrane Vesicle (OMV) Incorporation

    • Assess feasibility of incorporating nuoA into OMVs as a delivery platform

    • Compare with successful approaches used for other antigens like LTB

    • Evaluate stability and consistent production in OMV formulations

  • Immunogenicity Evaluation

    • Design animal experiments to test nuoA-based formulations

    • Administer via appropriate routes (e.g., intraperitoneal) with control groups

    • Evaluate antibody responses via indirect ELISA and protection in challenge studies

Recombinant nuoA could potentially be incorporated into existing vaccine platforms, such as outer membrane vesicles, which have shown promise for Shigella vaccines. The OMV approach allows for "consistent production" of antigens and can provide "cross-protection against both bacterial pathogens in a stable, non-replicating vaccine platform" .

Table 6: Vaccine Development Workflow for Recombinant nuoA

Development StageMethodologyAssessment CriteriaDecision Point
In silico assessmentEpitope prediction, conservation analysisEpitope scores, % conservationProceed if conserved epitopes identified
Expression optimizationMultiple systems, solubility enhancementYield, purity, conformationSelect system with highest quality protein
Immunogenicity testingMouse immunization, antibody ELISAIgG titers, epitope recognitionAdvance if significant immune response
Challenge studiesBacterial challenge after immunizationSurvival rate, bacterial clearanceProceed if protection demonstrated

Given WHO's recognition that "the development of a Shigella vaccine is an important goal for public health" , exploring unconventional antigens like nuoA may contribute to the comprehensive protection needed for effective vaccine strategies.

What comparative studies between Shigella flexneri and E. coli can be performed using recombinant nuoA?

Comparative studies of recombinant nuoA between Shigella flexneri serotype 5b and Escherichia coli can provide valuable insights into evolutionary adaptations, functional differences, and potential therapeutic targets. These closely related organisms share high genomic similarity but exhibit distinct pathogenic capabilities, making them excellent subjects for comparative biochemical analysis.

Methodological approaches for comparative studies:

  • Structural Comparison

    • Express and purify nuoA from both organisms under identical conditions

    • Perform structural analyses (CD spectroscopy, crystallography if feasible)

    • Identify serotype-specific structural features that may relate to function

  • Functional Comparison

    • Measure enzymatic parameters (Km, Vmax, substrate specificity)

    • Assess inhibitor sensitivity profiles

    • Evaluate activity under different environmental conditions (pH, temperature, oxygen levels)

  • Protein-Protein Interaction Analysis

    • Compare interaction patterns with other respiratory complex components

    • Identify differential binding partners using pull-down or crosslinking approaches

    • Map interaction networks specific to each organism

  • Complementation Studies

    • Test functional interchangeability through genetic complementation

    • Evaluate whether S. flexneri nuoA can substitute for E. coli nuoA and vice versa

    • Identify functional domains responsible for organism-specific activities

Particularly relevant is the comparison of gene essentiality between these organisms. Previous studies found "only a small number of genes that are important for growth in Shigella flexneri, yet not in Escherichia coli" . Determining whether nuoA exhibits differential essentiality or function could provide insights into Shigella's adaptation to its pathogenic lifestyle.

Table 7: Comparative Analysis Parameters for nuoA Studies

ParameterMethodological ApproachExpected DifferencesBiological Significance
Enzyme kineticsSpectrophotometric activity assaysAltered substrate affinityAdaptation to different metabolic environments
Protein stabilityThermal shift assays, limited proteolysisDifferent denaturation profilesEvolution of structural robustness
Complex assemblyBlue native PAGE, crosslinking MSDifferential subunit interactionsOptimization for specific electron transport chains
Gene essentialityConditional knockdown, growth curvesContext-dependent essentialityAdaptation to pathogenic lifestyle

Such comparative studies may reveal "how quickly the functions of proteins change over time" and potentially identify "targets for developing strain-specific antibiotic treatments" , with particular relevance to understanding Shigella's metabolic adaptations during pathogenesis.

How can structural studies of recombinant nuoA inform antimicrobial development?

Structural studies of recombinant Shigella flexneri nuoA can significantly inform antimicrobial development by identifying unique structural features that can be targeted for selective inhibition. As a component of the electron transport chain, nuoA represents a potential target for novel antibiotics, particularly if structural differences between Shigella and commensal bacteria can be exploited.

Methodological approach for structure-based drug discovery:

  • High-Resolution Structure Determination

    • Express and purify sufficient quantities of recombinant nuoA for structural studies

    • Apply X-ray crystallography or cryo-EM approaches for structure determination

    • Develop membrane mimetics to maintain native conformation during analysis

  • Comparative Structural Analysis

    • Superimpose structures with homologs from commensal bacteria

    • Identify Shigella-specific structural features or conformations

    • Map sequence divergence onto structural models to identify selective targeting opportunities

  • Binding Site Identification

    • Perform computational pocket analysis to identify druggable sites

    • Use fragment screening or molecular dynamics to identify binding hotspots

    • Focus on sites that differ between Shigella and commensal homologs

  • Structure-Based Drug Design

    • Employ virtual screening against identified pockets

    • Design compounds with selectivity for Shigella nuoA

    • Develop structure-activity relationships through iterative design

  • Functional Validation

    • Test candidate inhibitors against recombinant proteins from multiple species

    • Measure inhibition constants and selectivity indices

    • Validate cellular activity against intact bacteria

Table 8: Structure-Based Drug Discovery Pipeline for nuoA Inhibitors

StageMethodologySuccess CriteriaExpected Outcome
Structure determinationX-ray crystallography, cryo-EMResolution < 3ÅDetailed structural model
Pocket identificationComputational binding site predictionDruggable score > 0.7Targetable binding sites
Virtual screeningMolecular docking of compound librariesBinding energy < -8 kcal/molLead compounds
Enzymatic validationActivity assays with purified proteinIC50 < 10 μM, selectivity > 10xValidated hits
Cellular validationGrowth inhibition, membrane potentialMIC < 32 μg/mLCell-active compounds

This approach aligns with the need for novel antibiotics given "the rise of antimicrobial-resistant enteric bacteria, particularly Shigella" . Structure-based drug design targeting nuoA could potentially address the growing concern of antimicrobial resistance while offering selectivity against pathogenic Shigella over commensal bacteria.

What statistical approaches should be used for analyzing enzymatic data from recombinant nuoA studies?

Analyzing enzymatic data from recombinant Shigella flexneri nuoA studies requires robust statistical approaches to ensure reliable and interpretable results. As a component of the electron transport chain, nuoA's enzymatic activity may exhibit complex kinetics and be sensitive to experimental conditions, necessitating careful statistical treatment.

Methodological framework for statistical analysis:

  • Experimental Design Considerations

    • Ensure adequate replication (minimum triplicate measurements)

    • Include appropriate controls for each experiment

    • Structure independent variables in the first column and dependent variables in subsequent columns of data tables

    • Calculate derived quantities (means, rates) in the final column

  • Data Quality Assessment

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Identify and address outliers using Grubbs' test or box plots

    • Assess homogeneity of variance with Levene's test

  • Basic Statistical Analysis

    • Calculate means, standard deviations, and standard errors

    • Determine confidence intervals for key parameters

    • Use paired t-tests for comparing conditions with the same protein preparation

  • Advanced Analysis for Enzyme Kinetics

    • Apply non-linear regression for determining Michaelis-Menten parameters

    • Use global fitting for inhibition studies

    • Employ statistical comparison of curves for different conditions

  • Multiple Condition Comparisons

    • Use ANOVA with post-hoc tests (Tukey, Bonferroni) for multiple conditions

    • Apply two-way ANOVA when testing multiple factors

    • Consider mixed models when dealing with batch effects

Table 9: Statistical Approach Selection Guide for nuoA Enzymatic Data

Data TypeAppropriate Statistical MethodRequired Sample SizeOutput Interpretation
Activity comparisonsUnpaired t-test or ANOVAn ≥ 3 per groupp < 0.05 indicates significant difference
Kinetic parametersNon-linear regression≥ 8 substrate concentrationsCompare parameters with non-overlapping 95% CIs
Inhibition studiesIC50 determination via sigmoid curve fitting≥ 7 inhibitor concentrationsCompare potency via IC50 values and 95% CIs
Environmental effectsTwo-way ANOVAn ≥ 3 for each condition combinationMain effects and interactions with p < 0.05

Presentation of statistical results should follow convention with clearly labeled tables showing means ± standard deviations/errors and significance levels. Graphical representation should include error bars and significance indicators, with kinetic data presented with fitted curves and residuals plots.

How should researchers interpret contradictory findings when comparing recombinant nuoA to native protein?

Interpreting contradictory findings when comparing recombinant Shigella flexneri nuoA to its native counterpart requires a systematic approach to identify and address potential sources of these discrepancies. Such contradictions are common in membrane protein studies and demand careful evaluation rather than immediate rejection of either dataset.

Methodological approach to resolving contradictions:

  • Systematic Source Identification

    • Evaluate expression system artifacts

      • Assess impact of fusion tags on protein function

      • Consider post-translational modification differences

      • Examine membrane composition differences

    • Assess purification-induced alterations

      • Analyze detergent effects on protein conformation

      • Consider loss of essential lipids or cofactors

      • Evaluate protein stability throughout purification

    • Examine experimental condition variations

      • Compare buffer compositions between studies

      • Assess temperature, pH, and ionic strength differences

      • Consider substrate quality and preparation methods

  • Validation Experiments

    • Design experiments to directly test hypothesized sources of contradiction

    • Include multiple methodological approaches to assess the same parameter

    • Develop native-like reconstitution systems to bridge the gap between recombinant and native studies

  • Reconciliation Framework

    • Apply a hierarchical approach to weight contradictory evidence

    • Consider which system more closely mimics physiological conditions

    • Evaluate methodological rigor of conflicting studies

When analyzing Tn-seq data (as might be used to study nuoA essentiality), it's important to address potential artifacts. Previous studies comparing Shigella and E. coli found that "controlling for such artifacts resulted in a much smaller set of discrepant genes" . This principle applies broadly to contradictory findings between recombinant and native systems.

Table 10: Contradiction Resolution Framework

Contradiction TypePotential CausesResolution ApproachValidation Method
Activity differencesDetergent effects, missing cofactorsLipid reconstitution, cofactor additionCompare activity in multiple systems
Structural differencesFusion tags, non-native foldingTag removal, folding optimizationCD spectroscopy, limited proteolysis
Interaction differencesMissing partners, artificial associationsCo-expression with partners, competition assaysIn vivo crosslinking, native PAGE
Localization differencesOverexpression artifacts, improper targetingExpression level titration, targeting sequence verificationFractionation controls, microscopy

This systematic approach prevents premature dismissal of contradictory findings and instead leverages them to gain deeper insights into nuoA's structure and function.

What bioinformatic tools are most valuable for analyzing Shigella flexneri nuoA sequence and predicting functional properties?

Bioinformatic analysis of Shigella flexneri serotype 5b nuoA sequence provides valuable insights for experimental design and functional prediction. A comprehensive bioinformatic workflow can guide recombinant protein studies by identifying critical functional residues, predicting structural features, and placing the protein in evolutionary context.

Methodological workflow for bioinformatic analysis:

  • Sequence Analysis and Conservation

    • Multiple sequence alignment of nuoA across Shigella serotypes and related organisms

    • Conservation analysis to identify functionally critical residues

    • Phylogenetic analysis to understand evolutionary relationships

  • Structural Prediction and Analysis

    • Secondary structure prediction using PSIPRED or JPred

    • Transmembrane topology prediction using TMHMM or Phobius

    • 3D structure modeling using AlphaFold2 or homology modeling approaches

  • Functional Domain and Motif Identification

    • Conserved domain analysis using NCBI CDD or InterPro

    • Functional motif identification using PROSITE or ELM

    • Post-translational modification site prediction

  • Protein-Protein Interaction Prediction

    • Coevolution analysis to predict interaction interfaces

    • Protein docking simulations with known complex components

    • Interface conservation analysis across species

  • Epitope Prediction and Antigenicity

    • B-cell epitope prediction for potential vaccine applications

    • T-cell epitope prediction for immunogenicity assessment

    • Antigenicity scoring using various prediction algorithms

Tools selected should follow a similar approach to that used in reverse vaccinology studies of Shigella proteins, where "different immunoinformatics tools" were used to evaluate "transmembrane domains, homology, conservation, antigenicity, solubility, and B- and T-cell prediction" .

Table 11: Bioinformatic Tools for nuoA Analysis

Analysis TypeRecommended ToolsOutput InterpretationApplication to nuoA Research
Sequence conservationConSurf, MUSCLE + SeaViewConservation scores by positionIdentify essential functional residues
Structural predictionAlphaFold2, PSIPRED, TMHMMStructural models, TM topologyGuide construct design, identify domains
Protein-protein interactionsGREMLIN, ComplexContactPredicted contact residuesDesign interaction studies
Epitope predictionBepiPred, NetMHCPredicted epitope regionsInform vaccine design approaches
Functional predictionGene Ontology, KEGGPredicted functionsGuide experimental hypotheses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.