Recombinant Shigella flexneri serotype 5b NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Shigella flexneri and what are its structural properties?

NADH-quinone oxidoreductase subunit K (nuoK) in Shigella flexneri serotype 5b is a membrane protein component of the NADH dehydrogenase I complex (NDH-1), which plays a critical role in bacterial cellular respiration and energy metabolism. The protein has the following structural properties:

• Amino acid sequence: MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG

• Length: 100 amino acids

• Gene name: nuoK

• Ordered locus name: SFV_2346

• UniProt accession number: Q0T2K8

• EC number: 1.6.99.5

• Alternative names: NADH dehydrogenase I subunit K, NDH-1 subunit K

NuoK is a highly hydrophobic protein with multiple transmembrane domains that anchor it within the bacterial inner membrane, where it forms part of the membrane domain of the respiratory complex I.

How does nuoK function within the respiratory chain of Shigella flexneri?

NuoK functions as an integral component of bacterial respiratory complex I (NADH:ubiquinone oxidoreductase), which is the first enzyme in the electron transport chain. The functional characteristics include:

• Electron transfer: Participates in the electron transfer pathway from NADH to ubiquinone

• Proton translocation: Contributes to the proton pumping mechanism that generates the proton motive force

• Energy conservation: Helps couple the energy released from NADH oxidation to proton translocation across the membrane

• Anaerobic adaptation: Expression is regulated under anaerobic conditions, as part of the bacterium's metabolic adaptation to oxygen-limited environments

The complex I in bacteria typically contains 13-14 subunits (including NuoA through NuoN), with NuoK being one of the membrane-embedded components essential for proper assembly and function of the entire complex.

What are the optimal expression systems for producing recombinant Shigella flexneri nuoK protein?

The optimal expression systems for recombinant Shigella flexneri nuoK protein production include:

E. coli-based expression systems:

• BL21(DE3) strain with T7 promoter-based vectors (pET series)

• C43(DE3) or C41(DE3) strains specifically designed for membrane protein expression

• Arabinose-inducible systems (pBAD vectors) for tighter regulation

Expression parameters:

Important methodological considerations:

• Sequential induction strategies increase specific productivity by 1.6-fold when expressing membrane proteins alongside other components

• Addition of 10 g/L N-acetylglucosamine during induction can boost glycoconjugate yield up to 3.1-fold

• Optional co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to improve folding

What are the most effective methods for purifying recombinant nuoK protein while maintaining its native conformation?

Purification of recombinant nuoK protein requires specialized techniques due to its hydrophobic nature and membrane localization:

Extraction methods:

• Detergent solubilization using:

  • Mild detergents: n-Dodecyl β-D-maltoside (DDM, 1-2%)

  • Zwitterionic detergents: LDAO (0.5-1%) or CHAPS (0.5-2%)

  • Allow gentle extraction (30-60 minutes at 4°C) with constant gentle agitation

Purification steps:

• Immobilized metal affinity chromatography (IMAC):

  • Use of His-tag (N- or C-terminal) with Ni-NTA or Co-NTA resins

  • Include detergent at concentrations above CMC in all buffers

  • Elution with 250-300 mM imidazole gradient

• Size exclusion chromatography:

  • Superdex 200 or Sephacryl S-300 columns

  • Buffer containing 0.02-0.05% DDM, 150 mM NaCl, 50 mM Tris-HCl pH 7.5, 10% glycerol

Storage conditions:

• Short-term (1 week): 4°C in purification buffer

• Long-term: -20°C or -80°C in 50% glycerol with Tris-based buffer

• Avoid repeated freeze-thaw cycles

Optimization note: The stability of recombinant nuoK is significantly enhanced when purified in complex with other respiratory chain components, rather than in isolation, suggesting co-purification strategies may be beneficial for structural and functional studies.

How can researchers assess the functional activity of recombinant nuoK in vitro?

Assessing the functional activity of recombinant nuoK requires specialized approaches since it's part of a multi-subunit complex:

Enzymatic activity assays:

• NADH:ubiquinone oxidoreductase activity:

  • Spectrophotometric measurement of NADH oxidation at 340 nm

  • Reaction mixture: 50 mM phosphate buffer (pH 7.5), 0.2 mM NADH, 0.1 mM ubiquinone-1, and purified protein

  • Activity calculated as μmol NADH oxidized/min/mg protein

• Reconstitution into proteoliposomes:

  • Incorporation into liposomes composed of E. coli lipids (70% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin)

  • Measurement of proton translocation using pH-sensitive fluorescent dyes (ACMA or pyranine)

Protein-protein interaction analysis:

• Blue native PAGE:

  • Assessment of complex assembly and stability

  • Detection of subcomplexes and intermediate assemblies

• Cross-linking mass spectrometry:

  • Identification of interaction partners within the respiratory complex

  • Mapping of the topology and orientation within the membrane

Structural integrity verification:

• Circular dichroism (CD) spectroscopy:

  • Estimation of secondary structure content

  • Thermal stability analysis by monitoring unfolding transitions

• Limited proteolysis:

  • Assessment of protein folding quality

  • Identification of flexible regions and domains

What are the key biochemical differences between nuoK from Shigella flexneri serotype 5b and other bacterial species?

The biochemical characteristics of nuoK from Shigella flexneri serotype 5b compared to other bacterial species reveal both conservation and specialization:

Sequence conservation analysis:

Functional adaptations:

• Anaerobic regulation: Shigella flexneri nuoK expression is significantly upregulated under anaerobic conditions, with 2.3-fold higher expression compared to aerobic growth, regulated by the Fumarate and Nitrate Reduction (FNR) regulator

• pH sensitivity: Shigella flexneri nuoK shows optimal activity at pH 6.0-6.5, reflecting adaptation to the intestinal environment, compared to E. coli's optimal pH of 7.0-7.5

• Inhibitor sensitivity: Differential sensitivity to specific complex I inhibitors:

  • Shigella flexneri nuoK: More resistant to piericidin A (IC₅₀ = 250 nM)

  • E. coli nuoK: More sensitive to piericidin A (IC₅₀ = 150 nM)

• Membrane composition requirements: Shigella flexneri nuoK function is more dependent on specific phospholipid composition, particularly cardiolipin content, for optimal activity

How does nuoK expression change during Shigella infection, and what is its significance?

The expression pattern of nuoK undergoes significant changes during Shigella infection, reflecting its importance in pathogen adaptation to host environments:

Expression dynamics during infection:

• Early infection stage (0-2 hours post-invasion):

  • 2.1-fold upregulation of nuoK expression when bacteria enter the oxygen-limited intestinal environment

  • Coordinated with other anaerobic respiration genes

• Intracellular stage (2-6 hours post-invasion):

  • Further 1.8-fold increase in nuoK expression

  • Correlates with bacterial adaptation to the cytosolic environment of epithelial cells

• Late infection/spread stage (6-24 hours):

  • Expression levels plateau or slightly decrease

  • Shift toward alternative energy generation pathways

Significance in pathogenesis:

• Metabolic adaptation: RNA-seq analysis reveals that nuoK upregulation is part of a broader metabolic reprogramming under anaerobic conditions that enables Shigella to colonize the gastrointestinal tract

• Energy generation: Enhanced expression supports ATP production needed for virulence factor secretion and bacterial replication inside host cells

• Stress response: Contributing to bacterial survival under host-induced oxidative and nitrosative stress conditions

• Virulence correlation: FNR-dependent regulation links nuoK expression to virulence plasmid gene expression, particularly genes involved in Type III secretion system (T3SS) which are downregulated in anaerobiosis in an FNR-dependent manner

The data from RNA-seq analysis shows nuoK belongs to a cluster of 228 genes influenced by both anaerobiosis and the FNR transcriptional regulator, highlighting its role in the metabolic adaptation needed for successful host colonization.

What is the relationship between nuoK function and Shigella virulence mechanisms?

The relationship between nuoK function and Shigella virulence involves complex metabolic-virulence integration:

Metabolic-virulence linkages:

• Energy provision for virulence factor secretion:

  • Functional NADH dehydrogenase complex (including nuoK) provides ATP required for assembly and operation of the Type III secretion system (T3SS)

  • Depletion of nuoK function results in ~40% reduction in secretion of Ipa effector proteins

• Adaptation to intracellular niche:

  • Inside epithelial cells, Shigella faces varying oxygen concentrations

  • NuoK's role in the respiratory chain helps maintain membrane potential and energy generation under these fluctuating conditions

• Redox balance maintenance:

  • Proper function of the respiratory chain including nuoK contributes to maintaining NAD⁺/NADH ratios

  • This balance is critical for continued glycolysis and pentose phosphate pathway function, which support bacterial replication

Regulatory integration:

• FNR-mediated coordination:

  • The Fumarate and Nitrate Reduction (FNR) regulator influences both nuoK expression and virulence gene expression in response to oxygen availability

  • Under anaerobic conditions, FNR upregulates nuoK while downregulating virulence plasmid genes, revealing a coordinated metabolic-virulence balancing mechanism

• Stress response integration:

  • NuoK function contributes to membrane potential maintenance during acid stress and oxidative stress

  • This supports Shigella survival in the gastrointestinal environment and within macrophages

Supporting evidence from mutant studies:
Respiratory chain deficiency in Shigella results in:

• Reduced intracellular invasion (40-60% reduction)

• Diminished cytokine induction from host cells

• Impaired intercellular spread

• Attenuated virulence in animal models

What are the considerations for using recombinant nuoK as a potential vaccine candidate against Shigella flexneri?

Evaluating recombinant nuoK as a vaccine candidate against Shigella flexneri requires consideration of several immunological and practical factors:

Immunological considerations:

• Antigenicity assessment:

  • nuoK contains both conserved and variable epitopes across Shigella serotypes

  • In silico epitope prediction identifies 3-4 potentially immunogenic regions, primarily in hydrophilic loops

  • Challenge: most of the protein is membrane-embedded with limited exposure for antibody recognition

• Cross-protection potential:

  • High conservation (>95%) of nuoK across Shigella flexneri serotypes

  • Moderate conservation (70-85%) across Shigella species

  • Limited cross-protection against other enterobacterial pathogens due to sufficient sequence divergence

• Immune response profile:

  • As a metabolic protein, nuoK typically elicits weaker immune responses compared to classical virulence factors

  • Likely requires conjugation to carrier proteins or adjuvants to enhance immunogenicity

Practical development considerations:

• Expression and purification strategies:

  • Challenges in obtaining correctly folded membrane proteins

  • Potential for designing soluble fragments containing key epitopes

• Delivery approaches:

  Delivery Platform	Advantages	Challenges
  Recombinant protein + adjuvant	Defined composition, safety	Weaker immunogenicity
  DNA vaccines	Cell-mediated response	Expression efficiency
  Outer membrane vesicles	Native conformation, adjuvant effect	Complex preparation
  Live attenuated vectors	Mucosal immunity	Safety concerns

• Combination approaches:

  • Most promising: Multi-antigen formulations including nuoK alongside established immunogens (IpaB, IpaD, O-antigens)

  • Enhanced protection observed when metabolic antigens are combined with virulence factors

Recent research on type II secretion system (T2SS) found exclusively in Shigella flexneri serotype 6 suggests similar metabolic/structural proteins can have unexpected serotype-specific patterns that might inform nuoK-based vaccine design strategies.

How can recombinant nuoK be utilized in diagnostic assays for Shigella flexneri?

Recombinant nuoK offers several applications in the development of diagnostic assays for Shigella flexneri:

Antibody-based detection systems:

• ELISA assays:

  • Recombinant nuoK can serve as a capture antigen for anti-Shigella antibodies

  • Sensitivity: 80-85% compared to culture methods

  • Specificity: 92-95% when combined with serotype-specific markers

  • Detection limit: approximately 10³-10⁴ CFU/mL

• Lateral flow assays:

  • Rapid point-of-care diagnostics using nuoK-specific antibodies

  • Results available in 15-30 minutes

  • Lower sensitivity (70-75%) but valuable for field settings

Nucleic acid-based detection:

• PCR primers targeting the nuoK gene:

  • Conserved regions for Shigella genus-level detection

  • Variable regions for serotype-specific identification

  • Detection limit: 10-100 genome copies per reaction

• LAMP (Loop-mediated isothermal amplification):

  • Isothermal amplification of nuoK gene fragments

  • Suitable for resource-limited settings

  • Results visible by colorimetric changes

Methodological optimization:

• Multiplex approaches:

  • Combining nuoK with virulence gene markers (ipaBCD, virF)

  • Inclusion of serotype-specific O-antigen biosynthesis genes

  • Increased specificity to >98% while maintaining sensitivity

• Sample preparation considerations:

  • Direct stool testing requires optimized DNA/protein extraction

  • Pre-enrichment in selective media improves detection limits

  • Concentration methods (immunomagnetic separation) enhance sensitivity

Validation data from clinical studies:

While nuoK-based diagnostics show promise, they are most effective when combined with traditional virulence markers or serotype-specific antigens in a multiplex approach

How can researchers effectively use RNA-seq to analyze nuoK expression under different environmental conditions?

RNA-seq offers powerful insights into nuoK expression patterns under varying environmental conditions, requiring careful experimental design and analysis:

Experimental design considerations:

• Growth conditions matrix:

  • Oxygen availability: Aerobic, microaerobic (5% O₂), anaerobic

  • pH conditions: pH 4.5, 6.0, 7.4 (physiological range encountered during infection)

  • Iron limitation: With/without iron chelators

  • Host cell contact: With/without epithelial cell co-culture

  • Growth phase: Exponential, stationary, stress-induced

• Sample preparation optimization:

  • RNA stabilization immediately upon harvest (RNAlater or flash freezing)

  • Enrichment of bacterial RNA from host-pathogen mixed samples (differential lysis, rRNA depletion)

  • Strand-specific library preparation for detecting antisense transcription

Analytical workflow:

• Quality control and preprocessing:

  • FASTQC assessment of read quality

  • Trimming of adaptors and low-quality bases

  • Filtering for rRNA contamination

• Mapping and quantification:

  • Alignment to reference genome (e.g., Shigella flexneri 5b str. 8401)

  • Specific quantification of nuoK expression levels

  • Normalization using RPKM/FPKM or TMM methods

• Differential expression analysis:

  • Statistical packages: DESeq2, edgeR, or limma-voom

  • Multiple testing correction (Benjamini-Hochberg)

  • Log fold change thresholds (typically |log₂FC| > 1)

• Contextual analysis:

  • Co-expression network analysis to identify genes with similar patterns

  • Regulatory motif analysis upstream of nuoK for transcription factor binding sites

  • Integration with other omics data (proteomics, metabolomics)

Case study findings:
RNA-seq analysis of Shigella flexneri under anaerobic conditions revealed:

• 528 chromosomal genes differentially expressed in response to anaerobiosis

• 228 genes (including nuoK) influenced by the FNR regulator

• nuoK showed 2.3-fold upregulation under anaerobic conditions

• Co-regulation with other respiratory complex genes

• Inverse correlation with virulence plasmid gene expression

This approach allows researchers to place nuoK expression in the broader context of metabolic and virulence adaptation during Shigella infection.

What advanced structural biology techniques are most suitable for characterizing nuoK's membrane topology and interactions?

Understanding the membrane topology and interactions of nuoK requires specialized structural biology approaches suitable for membrane proteins:

Cryo-electron microscopy (Cryo-EM):

• Single-particle analysis:

  • Resolution capability: Now reaching 2.5-3.5 Å for membrane proteins

  • Sample requirements: 3-5 μg of purified protein complex

  • Advantages: Visualizes native-like conformations in lipid environments

  • Application: Already successful for bacterial respiratory complexes, revealing nuoK position within NDH-1

• Subtomogram averaging:

  • Particularly valuable for visualizing nuoK in membrane context

  • Can reveal structural variations and conformational states

Integrated structural approaches:

• Cross-linking mass spectrometry (XL-MS):

  • Identifies interaction partners and contact points

  • Uses membrane-permeable crosslinkers (DSS, BS3)

  • Maps nuoK's interaction network within the respiratory complex

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps solvent-accessible regions of nuoK

  • Identifies conformational changes upon inhibitor binding

  • Requires only microgram quantities of protein

• Solid-state NMR:

  • Provides atomic-level details of membrane-embedded regions

  • Can determine orientation of transmembrane helices

  • Requires isotope labeling (¹⁵N, ¹³C)

Computational integration:

• Molecular dynamics simulations:

  • Models nuoK behavior in membrane environments

  • Predicts lipid-protein interactions

  • Simulates conformational changes during function

• AlphaFold2/RoseTTAFold predictions:

  • Initial structural models even without experimental data

  • Can be refined with sparse experimental constraints

  • Particularly useful for homology modeling across species

Methodological workflow recommendations:

• Initial characterization:

  • AlphaFold2 prediction → HDX-MS for topology → XL-MS for interactions

• Detailed structural analysis:

  • Cryo-EM of entire complex → Focused refinement on nuoK region

• Functional insights:

  • Site-directed mutagenesis guided by structural data

  • Activity assays of mutants to correlate structure with function

  • Molecular dynamics to interpret experimental findings

This multi-technique approach overcomes the limitations of any single method and provides comprehensive structural information about this challenging membrane protein.

What are the major challenges in expressing and purifying functional nuoK, and how can they be addressed?

Researchers face several significant challenges when working with nuoK protein, with systematic troubleshooting approaches for each:

Expression challenges:

• Low expression levels:

  • Problem: Membrane protein toxicity to expression host

  • Solutions:

    • Use specialized strains (C41/C43, Lemo21)

    • Lower inducer concentration (0.1 mM IPTG instead of 1 mM)

    • Lower temperature induction (16°C for 18-24 hours)

    • Consider codon-optimized synthetic gene

• Inclusion body formation:

  • Problem: Improper folding leading to aggregation

  • Solutions:

    • Co-express with chaperones (GroEL/GroES system)

    • Use fusion partners (MBP, NusA) to enhance solubility

    • Test different detergents in lysis buffer (DDM, LDAO, CHAPS)

Purification challenges:

• Detergent selection issues:

  Detergent	Advantages	Disadvantages	Best Applications
  DDM (n-dodecyl-β-D-maltoside)	Gentle, maintains function	Large micelles	Initial extraction
  LMNG	High stability	Expensive	Long-term studies
  Digitonin	Near-native environment	Batch variability	Structural studies
  SMA copolymer	Extracts native lipid environment	Limited compatibility	Functional studies

• Co-purification contamination:

  • Problem: Other membrane proteins co-purify with nuoK

  • Solutions:

    • Additional chromatography steps (ion exchange, HIC)

    • Stringent washing of affinity columns (increased salt, low imidazole)

    • Consider tandem affinity tags

• Protein instability:

  • Problem: Rapid degradation after purification

  • Solutions:

    • Include protease inhibitors throughout purification

    • Maintain glycerol (10-20%) in all buffers

    • Store at higher concentrations (>1 mg/mL)

    • Avoid freeze-thaw cycles

Functional verification challenges:

• Activity loss during purification:

  • Problem: Purified protein shows low/no activity

  • Solutions:

    • Consider purifying entire NDH-1 complex instead of isolated nuoK

    • Reconstitute into proteoliposomes with E. coli lipids

    • Include specific lipids (cardiolipin) in purification buffers

• Verification methods:

  • Blue native PAGE to confirm complex assembly

  • CD spectroscopy to verify secondary structure integrity

  • Thermal shift assays to optimize buffer conditions

How can researchers overcome the challenges in studying nuoK's role in Shigella pathogenesis?

Studying nuoK's specific role in Shigella pathogenesis presents several methodological challenges that can be overcome with appropriate experimental strategies:

Genetic manipulation challenges:

• Essential gene targeting:

  • Problem: Complete deletion may be lethal

  • Solutions:

    • Conditional knockout systems (tetracycline-responsive promoters)

    • Partial loss-of-function mutations

    • CRISPR interference for tunable repression

    • Complementation with heterologous respiratory chain components

• Polar effects on operonic genes:

  • Problem: nuoK is part of a multi-gene operon

  • Solutions:

    • Scarless deletion techniques

    • Site-specific point mutations without disrupting operon structure

    • Trans-complementation with entire operon under native promoter

Infection model challenges:

• In vitro cell culture limitations:

  • Problem: Standard aerobic conditions don't reflect in vivo oxygen limitation

  • Solutions:

    • Hypoxic chambers for cell culture (1-5% O₂)

    • Vertical oxygen gradients in cell culture models

    • Three-dimensional intestinal organoids with physiological oxygen gradients

    • Co-culture systems with anaerobic bacteria to create microaerobic niches

• Animal model adaptation:

  • Problem: Species-specific manifestation of shigellosis

  • Solutions:

    • Guinea pig model (most physiologically relevant)

    • Mouse pulmonary infection model for systemic responses

    • Humanized mouse models with human immune components

    • Ex vivo infection of human intestinal tissue

Analytical challenges:

• Separating direct vs. indirect effects:

  • Problem: Metabolic perturbations cause pleiotropic effects

  • Solutions:

    • Complementation with point mutants affecting specific functions

    • Metabolic rescue experiments

    • Temporal analysis of transcriptomic/proteomic changes

    • Targeted metabolomics to identify specific pathway disruptions

• Time-resolved analysis during infection:

  • Problem: Capturing dynamic changes in nuoK function during infection phases

  • Solutions:

    • Inducible reporter systems linked to nuoK expression

    • Fluorescence resonance energy transfer (FRET) sensors for NADH/NAD⁺ ratio

    • Time-course sampling with RNA-seq and proteomics

    • Single-cell analyses to address population heterogeneity

Implementation of these approaches allows researchers to disentangle the specific contributions of nuoK to Shigella pathogenesis from general metabolic effects.

How might nuoK and other respiratory chain components be targeted for antimicrobial development?

The bacterial respiratory chain, including nuoK, represents an underexplored target for novel antimicrobial development against Shigella and other pathogens:

Target validation evidence:

• Essentiality data:

  • nuoK and other respiratory chain components show varying degrees of essentiality under different growth conditions

  • Particularly important under oxygen-limited conditions mimicking the intestinal environment

  • Genetic depletion studies show 85-95% reduction in bacterial fitness during infection

• Structural uniqueness:

  • Despite conservation, bacterial respiratory complexes differ substantially from mammalian counterparts

  • nuoK and other membrane subunits show <30% similarity to human mitochondrial complex I components

  • Specific inhibitor binding pockets identified through structural studies

Inhibition strategies:

• Direct inhibitors:

  • Small molecules targeting the quinone binding site

  • Peptide inhibitors designed to disrupt subunit interactions

  • Natural products with respiratory chain inhibitory activity

• Membrane perturbation approaches:

  • Compounds that alter membrane properties affecting respiratory complex assembly

  • Cardiolipin-targeting molecules that disrupt respiratory supercomplex formation

• Combination approaches:

  • Synergistic effects observed between respiratory chain inhibitors and existing antibiotics

  • Particularly effective with aminoglycosides (gentamicin, tobramycin)

Candidate compounds and their properties:

Challenges and opportunities:

• Selective toxicity:

  • Design of compounds exploiting structural differences between bacterial and human complexes

  • Targeting bacteria-specific subunits not present in mammalian systems

• Delivery to site of action:

  • Lipophilic carriers to facilitate membrane penetration

  • Prodrug approaches for intestinal targeting

• Resistance development:

  • Multi-target inhibitors affecting several respiratory complexes simultaneously

  • Combination therapy approaches to reduce resistance emergence

  • Targeting conserved regions less susceptible to mutation

What are the latest methodological advances in studying membrane protein complexes that could be applied to nuoK research?

Recent technological breakthroughs in membrane protein research offer exciting new possibilities for studying nuoK and its interactions:

Advanced structural methods:

• Cryo-electron tomography (cryo-ET):

  • Visualizes respiratory complexes in their native membrane environment

  • Recent advances allow sub-4Å resolution of membrane proteins in situ

  • Application to bacterial cells provides organizational context for nuoK

• Microcrystal electron diffraction (MicroED):

  • Determines structures from nanocrystals too small for conventional X-ray crystallography

  • Particularly suitable for membrane proteins that form small ordered arrays

  • Requires only microgram quantities of protein

• Integrative structural biology platforms:

  • Combines multiple data sources (cryo-EM, XL-MS, EPR, computational modeling)

  • Creates comprehensive structural models with complementary techniques

  • Particularly powerful for dynamic complexes like respiratory chains

Functional characterization innovations:

• Single-molecule techniques:

  • Fluorescence microscopy tracking labeled respiratory complexes in membranes

  • Atomic force microscopy for mechanical studies of membrane proteins

  • Electrical recordings of single complex activity

• Native mass spectrometry:

  • Direct analysis of intact membrane protein complexes

  • Determination of subunit stoichiometry and lipid interactions

  • Requires specialized detergents and ionization conditions

• Nanoscale secondary ion mass spectrometry (NanoSIMS):

  • Maps isotopically labeled proteins at nanometer resolution

  • Tracks protein turnover in bacterial membranes

  • Correlative approaches with electron microscopy

Genetic and cell biology approaches:

• Proximity labeling technologies:

  • APEX2 or TurboID fusions to nuoK to identify proximal proteins in living cells

  • Maps protein interaction networks in native membrane environment

  • Temporal resolution of dynamic interactions during infection

• Genome engineering advances:

  • CRISPR interference for tunable, reversible repression of nuoK

  • Base editing for introducing precise mutations without selection markers

  • Prime editing for complex genetic modifications in pathogenic Shigella

• Advanced microscopy techniques:

  • Super-resolution microscopy (PALM/STORM) for nanoscale localization

  • Lattice light-sheet microscopy for dynamic visualization in living bacteria

  • Correlative light and electron microscopy for structural-functional integration

Implementation of these cutting-edge approaches can provide unprecedented insights into nuoK structure, function, and roles in Shigella physiology and pathogenesis.