Recombinant Shigella flexneri serotype 5b Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; SFV_0637; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
kdpC
Target Protein Sequence
MSGLRPALSTFLFLLLITGGVYPLLTTALGQWWYPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDASTNVPVEL VTASASGLDNNITPQAAAWQIPRIAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links

KEGG: sfv:SFV_0637

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the genomic context of kdpC in Shigella flexneri serotype 5b?

The kdpC gene in S. flexneri serotype 5b strain 8401 (Sf8401) exists within the bacterial chromosome as part of the kdp operon, which typically includes kdpF, kdpA, kdpB, and kdpC genes. These genes encode the components of the high-affinity potassium transport system. Within the complete genome sequence of S. flexneri 5b, the genetic organization maintains high structural and functional conservation with other S. flexneri serotypes, including 2a . Comparative genomic analyses reveal that despite serotype differences, core metabolic genes like kdpC remain highly conserved across S. flexneri strains, though they may be subject to different selective pressures during evolution that can result in minor sequence variations .

How does kdpC function within the potassium transport system of S. flexneri?

The kdpC protein functions as the C subunit of the KdpFABC complex, which is a P-type ATPase system specialized for potassium transport under limiting conditions. In this complex, kdpC plays a critical role in stabilizing the interaction between the catalytic kdpB subunit and the kdpA channel component. The system operates through ATP hydrolysis to drive potassium uptake, with kdpC facilitating the conformational changes required for ion transport. In S. flexneri, this system becomes particularly important during infection when bacteria face potassium-limited environments within host cells. Functional studies of recombinant kdpC require careful evaluation of protein folding and complex assembly to ensure biological relevance in experimental systems.

What expression systems are most effective for producing recombinant S. flexneri serotype 5b kdpC?

For optimal recombinant expression of S. flexneri serotype 5b kdpC, several expression systems have proven effective with various advantages:

Expression SystemAdvantagesChallengesYield
E. coli BL21(DE3)High expression levels, genetic similarity to Shigella, established protocolsPotential inclusion body formation3-5 mg/L culture
E. coli RosettaEnhanced expression of rare codonsHigher cost4-6 mg/L culture
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, lower yield0.5-1 mg/L reaction

Methodologically, optimizing recombinant kdpC production requires careful consideration of induction parameters (temperature, IPTG concentration, induction time). For membrane-associated proteins like kdpC, expression at lower temperatures (16-20°C) with moderate inducer concentrations often yields properly folded protein. Addition of solubilizing agents or fusion tags (MBP, SUMO) can enhance solubility and subsequent purification efficiency.

How do sequence variations in kdpC between S. flexneri serotypes impact protein function and bacterial virulence?

Comparative analysis between S. flexneri serotype 5b and other serotypes (particularly 2a) demonstrates that while kdpC is generally conserved, subtle sequence variations exist that may impact protein function. These variations primarily occur in non-catalytic regions and may reflect adaptation to different host environments or potassium availability conditions .

Methodologically, researchers investigating functional differences should:

  • Perform multiple sequence alignments across serotypes to identify variable regions

  • Generate site-directed mutants targeting these variable residues

  • Conduct complementation assays in kdpC-deficient strains under potassium-limiting conditions

  • Assess potassium uptake kinetics using 86Rb+ as a tracer or potassium-selective electrodes

  • Evaluate virulence impacts through infection models, comparing wild-type and mutant strains

Research indicates that while kdpC may not directly function as a virulence factor, its role in potassium homeostasis becomes critical during host cell invasion and intracellular survival. Dysfunction in potassium uptake systems can significantly impact the ability of S. flexneri to withstand host defense mechanisms and maintain metabolic functions during infection .

What challenges exist in structural characterization of recombinant S. flexneri serotype 5b kdpC?

Structural characterization of recombinant kdpC presents several methodological challenges:

ChallengeSolution ApproachTechnical Considerations
Membrane associationDetergent screening (DDM, LMNG, C12E8)Different detergents may affect protein stability and crystal formation
Complex formationCo-expression with KdpB or entire complexRequires multi-plasmid systems or polycistronic constructs
Conformational heterogeneityNanobody stabilizationSelection of conformation-specific nanobodies
Crystal formationLipidic cubic phase crystallizationRequires specialized equipment and expertise

Recent advances in cryo-EM have provided an alternative approach to crystallography for membrane protein complexes like KdpFABC. For successful structural studies, researchers should consider:

  • Generating highly purified protein (>95% by SDS-PAGE)

  • Confirming proper folding through circular dichroism

  • Verifying complex formation through size-exclusion chromatography

  • Optimizing buffer conditions (pH, ionic strength, additives) for structural studies

  • Employing both detergent-based and nanodisc/liposome reconstitution for functional validation

How does the evolution of S. flexneri serotype 5b kdpC compare with other pathogens in the context of host adaptation?

Evolutionary analysis suggests that S. flexneri serotype 5b kdpC has undergone selection pressures distinct from other serotypes, potentially reflecting differences in host adaptation mechanisms . When comparing with other enteric pathogens, several patterns emerge:

  • Core functional domains show high conservation across Enterobacteriaceae

  • Surface-exposed regions display greater variability, potentially reflecting host immune pressures

  • Regulatory elements of the kdp operon show divergence related to niche adaptation

To methodologically approach this question, researchers should:

  • Perform phylogenetic analyses integrating kdpC sequences from diverse pathogens

  • Calculate selection pressures (dN/dS ratios) across different protein domains

  • Correlate sequence variation with known host range and tissue tropism

  • Conduct heterologous complementation studies to assess functional conservation

  • Evaluate expression patterns under host-relevant stress conditions

The genome sequences of S. flexneri provide evidence that while serotype conversion genes vary significantly between strains, core metabolic systems like potassium transporters maintain their fundamental functions despite evolutionary pressures . This suggests that kdpC represents an evolutionarily stable component of bacterial physiology, even as virulence factors and surface antigens undergo more rapid diversification.

What are the optimal methods for assessing the functional activity of recombinant S. flexneri serotype 5b kdpC?

To evaluate the functional activity of recombinant kdpC, several complementary approaches can be employed:

MethodAdvantagesLimitationsKey Parameters
Potassium uptake assaysDirect functional assessmentRequires specialized equipmentK+ concentration range, time course
Growth complementationPhysiological relevanceIndirect measureMedia K+ concentration, growth rate
ATPase activity assaysQuantitative enzymatic measureRequires reconstituted complexATP concentration, pH, temperature
Protein-protein interactionAssesses complex formationNot direct functional measureBinding affinity, complex stability

Methodologically, researchers should:

  • Generate a kdpC knockout strain of S. flexneri or E. coli for complementation studies

  • Express recombinant kdpC under native or inducible promoters

  • Assess growth under potassium-limiting conditions (K+ < 0.1 mM)

  • Measure intracellular potassium concentrations using atomic absorption spectroscopy

  • Determine ATPase activity of reconstituted complexes containing recombinant kdpC

For protein-protein interaction studies, bacterial two-hybrid systems or surface plasmon resonance can effectively measure the interaction between kdpC and other components of the complex, particularly kdpB. These assays should be conducted under physiologically relevant conditions, considering the impact of potassium concentration on complex assembly and stability.

How can researchers effectively study the role of S. flexneri serotype 5b kdpC in infection models?

Investigating the role of kdpC in infection requires methodological approaches that bridge molecular and cellular scales:

  • Generate defined kdpC mutants using allelic exchange or CRISPR-Cas9

  • Complement mutants with wild-type or variant kdpC alleles

  • Assess bacterial survival under host-mimicking conditions (pH, antimicrobial peptides)

  • Perform infection assays in relevant cell models (epithelial cells, macrophages)

  • Evaluate in vivo colonization and pathogenesis in appropriate animal models

When designing infection experiments, researchers should consider the following methodological details:

Infection ModelApplicationsReadoutsKey Controls
Epithelial cell linesInvasion, intracellular survivalCFU counts, microscopyNon-invasive control strains
Polarized cell monolayersBarrier disruptionTransepithelial resistanceHeat-killed bacteria
Ex vivo intestinal explantsTissue tropismHistopathology, bacterial localizationAntibiotic-treated samples
Animal modelsIn vivo pathogenesisDisease score, tissue colonizationCompetitive index with WT

What transcriptomic approaches are most informative for understanding kdpC regulation in S. flexneri serotype 5b?

Transcriptomic analysis of kdpC regulation requires careful experimental design to capture the complex regulatory networks involved:

  • Design exposure conditions that mimic host environments (K+ limitation, pH shifts)

  • Prepare RNA samples with minimal degradation (RIN values >8)

  • Perform RNA-seq with sufficient depth (>20M reads per sample)

  • Include time-course sampling to capture regulatory dynamics

  • Validate key findings with qRT-PCR and reporter constructs

The following experimental design provides a framework for comprehensive analysis:

ConditionRationaleExpected OutcomeKey Comparisons
K+ limitation (0.02-2 mM)Trigger kdp operon expressionUpregulation of kdp genesDose-response relationship
Host cell infection (time course)Physiological relevanceDynamic expression patternIntracellular vs. extracellular
Osmotic stressRelated physiological stressCoordinate regulation with other systemsIsotonic vs. hypertonic
pH stressHost phagosomal conditionsImpact on expression and functionNeutral vs. acidic pH

Bioinformatic analysis should include:

  • Differential expression analysis (DESeq2, edgeR)

  • Co-expression network analysis to identify functional modules

  • Promoter motif analysis for transcription factor binding sites

  • Integration with existing datasets on S. flexneri gene regulation

  • Comparative analysis across serotypes to identify serotype-specific regulatory patterns

These approaches can reveal how kdpC regulation integrates into broader virulence networks, particularly in the context of host-pathogen interactions that are critical for S. flexneri pathogenesis .

How does kdpC function integrate with virulence mechanisms in S. flexneri serotype 5b?

The integration of kdpC function with virulence mechanisms occurs at multiple levels, requiring integrated experimental approaches:

  • Evaluate kdpC expression during different stages of infection (adhesion, invasion, intracellular replication)

  • Assess the impact of kdpC mutation on virulence factor expression and secretion

  • Determine whether potassium limitation serves as a signal for virulence gene expression

  • Investigate potential physical interactions between KdpC and virulence-associated proteins

Research on S. flexneri pathogenesis demonstrates that while kdpC itself is not a classical virulence factor like the IpaH family effectors , potassium homeostasis plays a critical supporting role in virulence. For example, intracellular S. flexneri must adapt to the potassium-limited environment of host cell compartments, making functional potassium transport systems essential for pathogenesis.

Comparison of serotype 5b with serotype 2a reveals that while surface antigen genes vary considerably between serotypes, core physiological systems like potassium transporters maintain high conservation . This suggests that kdpC function represents a fundamental requirement for bacterial fitness during infection, regardless of serotype-specific virulence mechanisms.

What are the implications of targeting kdpC in S. flexneri for antimicrobial development?

The evaluation of kdpC as an antimicrobial target requires systematic assessment of several key factors:

CriteriaAssessmentMethodological ApproachResearch Findings
EssentialityConditionally essentialGene deletion studies, growth assaysRequired for growth under K+ limitation
ConservationHighly conservedComparative genomics, structural analysisConserved across S. flexneri serotypes
DruggabilityModerateStructure-based screening, fragment-based designPotential binding pockets identified
SelectivityChallengingComparative analysis with human transportersBacterial-specific features present

Methodologically, researchers investigating kdpC as a drug target should:

  • Perform comprehensive essentiality screening across relevant growth conditions

  • Conduct high-throughput screening for inhibitors using reconstituted systems

  • Develop cell-based assays to evaluate compound penetration and efficacy

  • Assess impact on bacterial viability in infection-relevant conditions

  • Evaluate potential for resistance development through experimental evolution

The emergence of multidrug-resistant S. flexneri strains, as documented in recent surveillance studies , underscores the importance of novel target exploration. While classical targets like cell wall synthesis and protein translation remain primary foci, membrane transport systems like kdpC represent potentially valuable alternative targets, particularly for combination therapy approaches targeting bacterial adaptation to host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.