Recombinant Shigella flexneri serotype 5b Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Functional Role

Recombinant Shigella flexneri serotype 5b Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) is a 128-amino acid protein (UniProt ID: Q0T2M4) expressed in E. coli with an N-terminal His tag . This protein facilitates the flipping of undecaprenyl phosphate-α-L-Ara4N (a lipid-linked sugar) across the inner bacterial membrane, a critical step in lipid A modification that confers resistance to polymyxin antibiotics .

Key functional domains:

  • Transmembrane helices for lipid interaction

  • Cytosolic ATP-binding domain (inferred from flippase homology )

Genomic Context and Evolutionary Significance

ArnF is encoded by the arnF gene (locus SFV_2329) within the arn operon of S. flexneri 5b . Comparative genomics reveals:

  • Horizontal gene transfer: The arn operon was likely acquired via bacteriophage-mediated integration .

  • Serotype specificity: S. flexneri 5b retains ArnF, while serotype 2a lost this gene through recombination events .

  • Pathogenicity link: Lipid A modification enhances survival in host tissues by evading cationic antimicrobial peptides .

Biochemical Mechanism of Action

ArnF operates as part of a heterodimeric flippase complex with ArnE :

  1. Substrate recognition: Binds undecaprenyl phosphate-α-L-Ara4N on the cytoplasmic membrane face.

  2. Translocation: Utilizes ATP hydrolysis to flip the substrate to the periplasmic side .

  3. Coordination: Requires MsbA (lipid A flippase) for subsequent transfer of L-Ara4N to lipid A .

This mechanism enables S. flexneri to modify its outer membrane, reducing permeability to polymyxins .

Antibiotic Resistance Studies

  • Polymyxin resistance: Deletion of arnF increases colistin susceptibility by 32-fold .

  • Diagnostic targets: ELISA kits using recombinant ArnF detect colistin-resistant strains (sensitivity: 93% ).

Vaccine Development

While not directly used in current vaccines, ArnF homologs inform strategies for:

  • Attenuated live vectors (e.g., aroD mutants )

  • O-antigen engineering (critical for serotype-specific immunity )

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are defaulted with standard blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize development with the specified tag.
Synonyms
arnF; SFV_2329; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
arnF
Target Protein Sequence
MGLIWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGREGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function
This protein is responsible for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: sfv:SFV_2329

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of the ArnF protein in Shigella flexneri?

ArnF functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, which is involved in lipopolysaccharide (LPS) modification pathways. The protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose (Ara4N) across the cytoplasmic membrane, a critical process in modifying the lipid A portion of LPS. This modification plays a significant role in antimicrobial peptide resistance and bacterial survival in hostile environments .

To study this function:

  • Use radiolabeled substrate tracking assays to measure flippase activity

  • Employ reconstituted proteoliposome systems to analyze ArnF-mediated translocation

  • Apply site-directed mutagenesis to identify essential residues for substrate binding and transport

How does the ArnF protein structure compare between Shigella flexneri and other Gram-negative pathogens?

Comparative structural analysis of ArnF proteins reveals high conservation across several Gram-negative pathogens. The AlphaFold-predicted structure of S. flexneri ArnF shows similarity to those from Yersinia pestis (pLDDT score: 92.65) and Escherichia coli (pLDDT score: 79.85) . All three organisms produce ArnF proteins of approximately 128 amino acids with conserved transmembrane regions.

Key structural comparisons:

OrganismProtein LengthGlobal pLDDT ScoreConfidence ClassificationKey Structural Features
Yersinia pestis Angola128 aa92.65Very high confidenceMultiple transmembrane helices
Escherichia coli APEC O1128 aa79.85ConfidentSimilar helical organization
Shigella flexneri 5b128 aaNot provided in search resultsPresumed confidentPredicted membrane spanning regions

Researchers should use techniques like circular dichroism, X-ray crystallography, or cryo-EM to validate these computational predictions when working with recombinant ArnF proteins.

What are the optimal conditions for expressing recombinant ArnF from S. flexneri serotype 5b?

Expression of recombinant membrane proteins like ArnF requires careful optimization. Based on successful approaches for similar proteins:

  • Expression system selection:

    • E. coli BL21(DE3) or C43(DE3) strains are recommended for membrane proteins

    • Alternatively, consider yeast (P. pastoris) or baculovirus systems for proper folding

  • Vector design considerations:

    • Include a C-terminal His-tag for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Incorporate a TEV protease cleavage site for tag removal

  • Induction parameters:

    • Lower temperatures (16-20°C) often improve membrane protein folding

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Extended expression times (16-24 hours)

  • Membrane fraction isolation:

    • Gentle lysis using lysozyme and sonication

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using appropriate detergents (DDM, LDAO, or C12E8)

The incorporation of molecular chaperones (GroEL/GroES) in the expression system may further enhance proper folding of this complex membrane protein.

What purification strategies yield the highest purity and activity for S. flexneri ArnF protein?

Successful purification of functional ArnF requires a multi-step approach:

  • Membrane protein extraction:

    • Solubilize membranes with n-dodecyl-β-D-maltoside (DDM) at 1-2% (w/v)

    • Maintain pH 7.5-8.0 with 50 mM Tris or phosphate buffer

    • Include glycerol (10-20%) for stability

  • Chromatography sequence:

    • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA

    • Size exclusion chromatography to remove aggregates

    • Optional ion exchange step for contaminant removal

  • Quality assessment methods:

    • SDS-PAGE with Coomassie and Western blotting

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for homogeneity

  • Activity preservation:

    • Maintain critical detergent concentration above CMC

    • Include stabilizing agents (glycerol, specific lipids)

    • Avoid freeze-thaw cycles; store at -80°C in single-use aliquots

For functional studies, reconstitution into proteoliposomes with E. coli polar lipid extract can help maintain native-like activity of the purified protein.

How does ArnF contribute to Shigella flexneri's antimicrobial resistance mechanisms?

ArnF plays a critical role in Shigella's resistance mechanisms through LPS modification:

The ArnF protein facilitates 4-amino-4-deoxy-L-arabinose (Ara4N) transfer to lipid A, which reduces the negative charge of the bacterial outer membrane. This modification decreases binding affinity of cationic antimicrobial peptides (CAMPs) and some antibiotics to the bacterial surface .

The resistance mechanism operates through:

  • Reduction of negative charge on LPS, diminishing electrostatic interaction with positively charged antimicrobials

  • Alteration of membrane permeability, limiting antibiotic penetration

  • Contribution to biofilm formation and persistence during infection

Research methodologies to study this resistance:

  • Gene knockout studies comparing wild-type and ΔarnF strains' susceptibility profiles

  • Minimum inhibitory concentration (MIC) assays with various antimicrobials

  • Membrane charge analysis using zeta potential measurements

  • Fluorescent dye uptake assays to quantify membrane permeability changes

This mechanism shares similarities with resistance patterns observed in other Gram-negative pathogens like Yersinia pestis and pathogenic E. coli, where ArnF homologs serve comparable functions .

What role does ArnF play in the serotype conversion and O-antigen modification in S. flexneri?

While ArnF itself is not directly involved in serotype conversion, its study provides insights into membrane-associated modification systems in S. flexneri. The search results indicate several related mechanisms:

S. flexneri serotypes are primarily determined by O-antigen modifications through:

  • Glucosylation by phage-encoded glucosyltransferases (gtr genes)

  • O-acetylation by acetyltransferases

  • Phosphoethanolamine (PEtN) modification via plasmid-encoded transferases

These modifications alter antigenic determinants and contribute to immune evasion. While not directly mediated by ArnF, these processes involve similar membrane-associated translocation mechanisms.

Methodology for studying serotype-specific modifications:

  • Phage isolation and characterization (as seen with bacteriophage Sf101)

  • Genomic and plasmid profiling

  • Mass spectrometry analysis of LPS modifications

  • Nuclear magnetic resonance (NMR) spectroscopy to confirm functional modifications

The discovery that "Sf101 was found to integrate in the sbcB locus representing a new genomic location of oacB gene" demonstrates how researchers can identify novel integration sites for modification genes, a methodology potentially applicable to ArnF-related studies.

How can recombinant ArnF be utilized in vaccine development against Shigellosis?

ArnF represents a potential vaccine candidate given its outer membrane localization and role in bacterial survival. Based on vaccine development strategies seen with other Shigella proteins:

  • ArnF-based vaccine platforms:

    • Recombinant protein subunit vaccines with appropriate adjuvants

    • DNA vaccines encoding ArnF

    • Outer membrane vesicle (OMV)-based delivery incorporating ArnF

  • Design considerations:

    • Target conserved epitopes across serotypes for broad protection

    • Combine with other immunogenic proteins (like TolC, which "depicted effective protection against 2 LD50 of shigella flexneri ATCC12022")

    • Use reverse vaccinology approach to identify immunodominant regions

  • Experimental evaluation:

    • BALB/c mouse immunization models with intraperitoneal administration

    • IgG1 production assay by indirect-ELISA for humoral response assessment

    • Challenge studies with virulent S. flexneri strains

    • T-cell response analysis through cytokine profiling

A multi-antigen approach may be most effective, as seen in research where "a recombinant Shigella flexneri strain with the novel incorporation of the eltb gene for the heat-labile enterotoxin B (LTB) subunit of ETEC directly into Shigella's genome" showed promise for "cross-protection against both bacterial pathogens" .

What methods are most effective for analyzing ArnF-substrate interactions in vitro?

Understanding ArnF-substrate interactions requires specialized techniques for membrane protein analysis:

  • Binding affinity determination:

    • Surface plasmon resonance with immobilized ArnF

    • Isothermal titration calorimetry in detergent micelles

    • Microscale thermophoresis for detecting interaction in solution

  • Structural characterization of complexes:

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Site-directed spin labeling with EPR spectroscopy

    • In silico molecular docking validated by mutational studies

  • Functional reconstitution approaches:

    • Proteoliposome-based flippase assays with fluorescent Ara4N analogues

    • Stopped-flow spectroscopy to measure kinetics of substrate translocation

    • Development of cell-free translation systems with supplied lipids

  • Data analysis considerations:

    • Account for detergent effects on binding parameters

    • Analyze thermodynamic versus kinetic control of interactions

    • Compare wild-type versus mutant proteins to identify critical residues

These methods can help establish structure-function relationships and potentially identify inhibitor molecules targeting ArnF as novel antimicrobials.

How is ArnF expression regulated in response to environmental signals during infection?

The regulation of ArnF likely responds to host environmental cues, similar to other virulence factors in S. flexneri:

  • Identified regulatory mechanisms:

    • Two-component systems responding to environmental pH, antimicrobial peptides, or host signals

    • Integration with the PhoPQ and PmrAB systems known to regulate LPS modification genes

    • Potential regulation by colonic fatty acids, which have been shown to "repress S. flexneri virulence, allowing it to energetically finance its proliferation"

  • Experimental approaches to study regulation:

    • Transcriptional reporter fusions (arnF-lacZ) to monitor expression

    • Chromatin immunoprecipitation to identify transcription factor binding

    • RNA-seq analysis under various environmental conditions

    • Electrophoretic mobility shift assays to confirm direct regulator binding

  • Host signals that may influence expression:

    • Antimicrobial peptides from intestinal epithelial cells

    • Bile salts and fatty acids in the intestinal environment

    • pH fluctuations during passage through the gastrointestinal tract

    • Oxygen limitation in the intestinal lumen

Understanding these regulatory networks can provide insights into when and where ArnF modification becomes critical during infection, potentially revealing new therapeutic intervention points.

What methodologies are most appropriate for studying ArnF interactions with other proteins in the Arn pathway?

ArnF functions within the multi-protein Arn modification system, necessitating specialized approaches to study protein-protein interactions:

  • In vivo interaction studies:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Split-GFP complementation assays

    • FRET-based approaches with fluorescently tagged proteins

    • In vivo crosslinking followed by co-immunoprecipitation

  • Membrane protein complex isolation:

    • Native PAGE analysis of digitonin-solubilized membranes

    • Blue native PAGE for preserving complexes

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Chemical crosslinking combined with mass spectrometry (XL-MS)

  • Reconstitution of complete pathways:

    • Co-expression of multiple Arn pathway components

    • Liposome reconstitution with purified components

    • Activity assays measuring complete Ara4N transfer to lipid A

  • Computational approaches:

    • Protein-protein docking simulations

    • Molecular dynamics of membrane-embedded complexes

    • Coevolutionary analysis to identify interaction interfaces

These methodologies should be applied systematically to map the entire interaction network of the Arn pathway, with special attention to membrane-associated interactions that are traditionally challenging to characterize.

What are the most common challenges in working with recombinant ArnF and how can they be overcome?

Researchers face several technical challenges when working with this membrane protein:

  • Protein aggregation and inclusion body formation:

    • Solution: Use mild detergents (DDM, LDAO) and optimize expression temperature (16-20°C)

    • Develop refolding protocols from inclusion bodies if necessary

    • Consider fusion partners that enhance solubility (MBP, SUMO)

  • Low expression yields:

    • Solution: Test multiple expression systems (E. coli C43(DE3), yeast, insect cells)

    • Optimize codon usage for expression host

    • Use strong but controllable promoters with tight regulation

  • Protein instability after purification:

    • Solution: Include stabilizing additives (glycerol 10-20%, specific lipids)

    • Identify optimal buffer conditions through thermal shift assays

    • Consider nanodiscs or amphipols for maintaining native-like environment

  • Functional assay limitations:

    • Solution: Develop liposome-based flippase assays with fluorescent substrates

    • Establish indirect measurements of activity (e.g., coupled enzyme assays)

    • Use computational predictions to guide assay development

  • Limited structural information:

    • Solution: Validate AlphaFold predictions with experimental approaches

    • Use targeted approaches like hydrogen-deuterium exchange mass spectrometry

    • Apply crosslinking and cysteine accessibility methods to probe topology

Each challenge requires a systematic approach to optimization, with careful documentation of conditions that improve protein yield, stability, and activity.

How should researchers interpret contradictory data regarding ArnF function across different bacterial species?

When encountering contradictory results across species:

  • Standardize experimental conditions:

    • Use identical buffer compositions, pH, and temperature

    • Ensure protein constructs have comparable boundaries

    • Develop consistent activity assay protocols

  • Consider species-specific adaptations:

    • Compare sequence alignments to identify variable regions

    • Examine gene synteny and operon structure differences

    • Investigate regulatory network variations

  • Account for methodological differences:

    • In vitro versus in vivo studies may yield different results

    • Recombinant versus native protein behavior can differ

    • Expression systems may affect post-translational modifications

  • Validate with multiple approaches:

    • Complement genetic studies with biochemical assays

    • Use both gain- and loss-of-function experiments

    • Apply cross-species complementation tests

  • Data integration framework:

    • Create comprehensive models incorporating all data points

    • Weight evidence based on methodological strength

    • Identify conditions under which contradictions emerge

The comparison of ArnF between S. flexneri, Y. pestis, and E. coli demonstrates structural similarities but may reveal functional differences that reflect adaptation to specific host environments and pathogenic lifestyles.

What emerging technologies show promise for advancing our understanding of ArnF structure and function?

Several cutting-edge approaches hold potential for deeper insights into ArnF:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for membrane protein structures without crystallization

    • Micro-electron diffraction (MicroED) for small crystals

    • Integrative structural biology combining multiple data sources

    • Serial femtosecond crystallography using X-ray free electron lasers

  • Single-molecule methodologies:

    • Single-molecule FRET to observe conformational changes during substrate transport

    • High-speed atomic force microscopy to visualize membrane protein dynamics

    • Nanopore-based electrical recordings of individual flippase events

    • Single-particle tracking in live bacteria

  • Genetic and genomic innovations:

    • CRISPR interference for precise temporal regulation of expression

    • Deep mutational scanning to map structure-function relationships

    • Ribosome profiling to examine translational regulation

    • Transcriptome-wide analyses of regulatory responses

  • Computational advances:

    • Machine learning for improved structure prediction

    • Molecular dynamics simulations in complex membrane environments

    • Systems biology models integrating ArnF into broader LPS modification networks

    • Quantum mechanics/molecular mechanics approaches for catalytic mechanism studies

These technologies, particularly when used in combination, offer unprecedented potential to resolve outstanding questions about ArnF's structure, dynamics, substrate recognition, and regulation.

What is the potential for developing ArnF inhibitors as novel antimicrobials against multidrug-resistant Shigella?

The therapeutic targeting of ArnF represents a promising strategy against increasingly antibiotic-resistant Shigella strains:

  • Rationale for ArnF as a drug target:

    • Essential role in antimicrobial peptide resistance

    • Limited homology to human proteins

    • Membrane accessibility for drug binding

    • Potential broad-spectrum activity against multiple Gram-negative pathogens

  • Drug discovery approaches:

    • Structure-based virtual screening using AlphaFold models

    • Fragment-based screening against purified protein

    • Phenotypic screening for compounds that sensitize to antimicrobial peptides

    • Rational design targeting substrate binding sites

  • Evaluation frameworks:

    • In vitro inhibition assays with reconstituted flippase activity

    • Cell-based assays measuring LPS modification

    • Synergy testing with existing antibiotics

    • Animal infection models for in vivo efficacy

  • Potential advantages and challenges:

    • Advantage: Novel mechanism distinct from conventional antibiotics

    • Advantage: Potential to resensitize bacteria to host defenses

    • Challenge: Membrane penetration of inhibitors

    • Challenge: Potential for rapid resistance development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.