Recombinant Shigella flexneri serotype 5b Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant yciB Protein

The recombinant Shigella flexneri serotype 5b probable intracellular septation protein A (yciB) is a hypothetical protein annotated as being involved in bacterial cell septation. While the query specifically targets this protein, a critical analysis of available literature reveals no direct studies or data on yciB in Shigella flexneri serotype 5b. The provided search results focus exclusively on the yfiB gene (part of the YfiBNR tripartite signaling system in Shigella flexneri serotype 1c) and unrelated proteins in Salmonella dublin.

Lack of Data on yciB in Shigella flexneri Serotype 5b

  • No peer-reviewed studies or preprints addressing yciB in Shigella flexneri serotype 5b were identified in the provided sources.

  • The fifth source ( ) discusses a recombinant yciB protein from Salmonella dublin (Cat.No.: RFL28017SF), which is unrelated to Shigella and focuses on intracellular septation in a different pathogen.

Relevant Findings on yfiB in Shigella flexneri Serotype 1c

While unrelated to yciB, the YfiBNR system in Shigella flexneri serotype 1c provides insights into bacterial virulence mechanisms. Key findings include:

AspectObservationReference
FunctionYfiB regulates c-di-GMP levels via the YfiBNR system, impacting biofilm formation, invasion, and host-cell adhesion.
Experimental ResultsyfiB knockout strains showed 4-fold reduced invasion in BHK cells and impaired intercellular spread.
Structural InsightsYfiB’s N-terminal linker and conserved residues (e.g., Arg35, Ser55) are critical for YfiR sequestration and signaling.

Hypothesized Role of yciB in Bacterial Septation

Despite the absence of direct evidence, yciB is annotated as a "probable intracellular septation protein." Based on homologous proteins in other bacteria:

  • Proposed Function: May regulate cell division or septum formation during bacterial growth.

  • Molecular Characteristics: Likely contains conserved domains for membrane localization or binding to septation machinery.

Recommendations for Future Research

  1. Targeted Knockout Studies: Generate yciB deletion mutants in Shigella flexneri serotype 5b to assess septation defects.

  2. Protein Interaction Mapping: Identify binding partners of yciB using co-IP or yeast-two-hybrid assays.

  3. Structural Analysis: Solve the crystal structure of yciB to elucidate functional motifs.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing that tag for you.
Synonyms
yciB; SFV_1268; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLSKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: sfv:SFV_1268

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YciB and what is its structural characterization in Shigella flexneri?

YciB (Probable Intracellular Septation Protein A) in Shigella flexneri is a homologue of ispA that plays critical roles in cell division and intracellular spreading. The protein consists of 179 amino acid residues organized into five transmembrane domains, with its C-terminus located in the cytoplasm and a short N-terminal region positioned in the periplasm. This specific membrane topology is essential for its functional interactions with both cytoplasmic and periplasmic proteins involved in cell division and cell wall synthesis processes .

How does YciB function differ between Shigella flexneri and Escherichia coli?

While YciB functions are largely conserved between these closely related species, there are notable differences:

SpeciesPrimary FunctionKey InteractionsPhenotypic Effects of Deletion
S. flexneriCell division and intracellular spreadingInteracts with cell division and elongation proteinsShorter cells, sensitivity to low osmolarity
E. coliCell envelope integrity maintenanceSynergistic relationship with DcrB (inner membrane lipoprotein)Defective lipoprotein maturation, activation of envelope stress response systems

In E. coli, YciB works synergistically with DcrB, and deletion of both genes results in synthetic lethality due to defects in lipoprotein maturation . The comparable functional relationship in S. flexneri has not been fully characterized, though YciB clearly affects cell division processes in both organisms .

What experimental evidence confirms YciB's role in cell division?

Several experimental approaches have confirmed YciB's involvement in cell division:

  • Deletion mutant studies show that ΔyciB cells are shorter than wild-type cells, indicating disruption of normal cell elongation processes .

  • Bacterial two-hybrid (BACTH) analysis demonstrates that YciB interacts with various cell division and elongation proteins .

  • Fluorescence microscopy reveals that deletion of yciB affects the localization of ZipA and ZapA (key division proteins) but not FtsZ or FtsA .

  • Overexpression of YciB has been shown to cause cell elongation and growth toxicity, suggesting that YciB levels must be precisely regulated for normal division .

These complementary lines of evidence establish YciB as an important component of the bacterial cell division machinery, particularly in spatial organization of specific divisome components.

How does YciB contribute to cell envelope integrity and what stress response systems are activated in its absence?

YciB plays a crucial role in maintaining cell envelope integrity through multiple mechanisms. In E. coli, the combined deletion of yciB and dcrB results in defective lipoprotein maturation at the first step catalyzed by Lgt (phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase) . This leads to mislocalization of lipoproteins, particularly the abundant outer membrane lipoprotein Lpp, which forms toxic linkages to peptidoglycan when incorrectly localized to the inner membrane .

The envelope stress caused by YciB absence activates two primary stress response systems:

  • Cpx pathway: Activated in both ΔyciB single mutants and ΔyciB dcrB double mutants, though more strongly in the latter. Interestingly, this activation occurs independently of NlpE, suggesting an alternative mechanism of Cpx induction .

  • Rcs pathway: Strongly activated in ΔyciB dcrB double mutants, primarily through the accumulation of the lipoprotein RcsF at the inner membrane .

The differential activation of these stress responses provides important insight into the specific envelope defects caused by YciB absence and offers valuable experimental readouts for assessing YciB function under various conditions.

What is the relationship between YciB and the bacterial cell elongation machinery?

YciB demonstrates complex interactions with the bacterial cell elongation machinery:

  • ΔyciB mutants exhibit increased sensitivity to A22, an inhibitor of MreB assembly, suggesting that YciB functionally supports the MreB-directed cell elongation system .

  • Deletion of yciB is synthetically lethal in ΔrodZ mutants, indicating overlapping or complementary functions between these proteins in the cell elongation process .

  • Remarkably, overexpression of YciB can suppress the sphere shape of ΔrodZ mutant cells, partially restoring rod morphology .

  • Despite these functional connections, BACTH analysis shows that YciB does not directly interact with MreB, suggesting that YciB influences cell elongation through interactions with other components of the elongation machinery .

These findings position YciB as a supporting element in RodZ-mediated lateral peptidoglycan synthesis, with MreB becoming more critical for maintaining membrane integrity in the absence of YciB.

What is known about YciB's role in lipoprotein maturation and how can researchers investigate this function?

Current evidence, primarily from E. coli studies, suggests that YciB contributes to efficient lipoprotein maturation, particularly at the first step catalyzed by Lgt . Researchers can investigate this function using several approaches:

Experimental ApproachMethodologyExpected Outcomes
Pulse-chase analysisLabel lipoproteins with radioactive amino acids and monitor their processing over time in WT vs. ΔyciB strainsIdentify specific steps in lipoprotein maturation affected by YciB absence
Subcellular fractionationSeparate membrane fractions and analyze lipoprotein distribution in WT vs. ΔyciB strainsDetermine if lipoproteins are mislocalized in the absence of YciB
Stress response reporter assaysUse transcriptional fusions to monitor Cpx and Rcs activationQuantify envelope stress caused by YciB deletion
Synthetic genetic array analysisTest interactions between yciB and genes involved in lipoprotein processingIdentify functional relationships with lipoprotein maturation machinery

The inefficiency in Lgt function observed in yciB mutants may be related to altered membrane fluidity or lipid composition, rather than direct changes in phosphatidylglycerol levels . This suggests that YciB might influence membrane properties that affect Lgt activity indirectly.

How can bacterial two-hybrid (BACTH) analysis be optimized for studying YciB protein interactions?

BACTH analysis has proven valuable for characterizing YciB's interaction network . To optimize this approach:

  • Construct Design: Create both N- and C-terminal fusions of YciB to T18 and T25 fragments, as the location of the adenylate cyclase fragment may affect protein folding or interaction interfaces. For YciB, consider the transmembrane topology when designing constructs to ensure that fusion does not disrupt membrane insertion.

  • Control Selection: Include positive controls (known interacting pairs) and negative controls (non-interacting proteins) specific to membrane proteins. For YciB studies, FtsA-FtsZ interaction serves as an appropriate positive control.

  • Quantification Method: While colony color on indicator plates provides qualitative assessment, β-galactosidase assays offer more quantitative measurements of interaction strength. This is particularly important for comparing YciB's interactions with different division and elongation proteins.

  • Verification Strategy: Confirm BACTH results with complementary approaches such as co-immunoprecipitation or fluorescence resonance energy transfer (FRET) where feasible.

  • Mutational Analysis: Create YciB variants with specific transmembrane domain mutations to map interaction interfaces with identified partner proteins.

Using this optimized approach, researchers have determined that YciB interacts with various cell elongation and division proteins but notably does not interact directly with MreB or FtsZ , providing insight into its position within the divisome network.

What microscopy techniques are most effective for visualizing YciB localization and function?

Several microscopy approaches can be employed to study YciB localization and function:

TechniqueApplication for YciB ResearchAdvantagesLimitations
Immunofluorescence microscopyVisualize native or epitope-tagged YciBWorks with fixed cells, high specificityRequires cell fixation, may alter membrane structures
Fluorescent protein fusionsTrack YciB dynamics in live cellsReal-time imaging, no fixation requiredFusion may affect protein function or localization
Super-resolution microscopy (STORM/PALM)Precise localization relative to other divisome componentsNanometer-scale resolutionComplex sample preparation, specialized equipment
Time-lapse microscopyMonitor YciB behavior during cell cycleCaptures dynamic processesPhotobleaching, phototoxicity concerns

Research using these techniques has revealed that YciB is not concentrated at the septum site but rather localizes along the membrane throughout the entire cell . Additionally, fluorescence microscopy has shown that the absence of YciB affects the localization of ZipA and ZapA but not FtsZ and FtsA , providing important clues about YciB's functional role in divisome assembly.

How can genetic approaches be used to resolve conflicting data about YciB function?

When conflicting data about YciB function emerges, several genetic approaches can help resolve discrepancies:

  • Suppressor Analysis: Identifying mutations that suppress yciB deletion phenotypes can clarify functional pathways. For example, in E. coli, the discovery that skp deletion suppresses yciB dcrB synthetic lethality through the σE-MicL-Lpp regulatory loop provided critical insight into the molecular basis of this interaction .

  • Domain Swap Experiments: Creating chimeric proteins by swapping domains between YciB homologs from different species can identify regions responsible for species-specific functions.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues can identify amino acids critical for specific YciB functions.

  • Conditional Alleles: Temperature-sensitive or chemically-inducible YciB variants allow temporal control of YciB function, helping to distinguish primary from secondary effects.

  • Transposon Insertion Sequencing (Tn-seq): Comparing the fitness effects of transposon insertions in yciB under different conditions can reveal condition-specific functions .

These approaches can reconcile apparently contradictory results by revealing context-dependent functions or identifying specific YciB domains associated with distinct activities.

How should researchers interpret growth phenotypes of YciB mutants under different stress conditions?

Growth phenotypes of YciB mutants provide valuable insights but require careful interpretation:

Stress ConditionΔyciB PhenotypeInterpretationControl Experiments
Low osmolarityIncreased sensitivityCompromised cell envelope integrityCompare with mutants affecting other envelope components
A22 treatmentIncreased sensitivityFunctional connection to MreB-directed cell wall synthesisTest other cell shape determinants for similar effects
Low temperatureNormal growth (unlike ΔdcrB)YciB function less critical for membrane fluidity adaptationExamine fatty acid composition in WT vs. mutant
Overexpression toxicityCell elongation, growth inhibitionDisruption of divisome assembly or functionAnalyze localization of division proteins during overexpression

When interpreting these phenotypes, researchers should consider several factors:

  • Pleiotropy: YciB affects multiple cellular processes, so phenotypes may reflect combined effects rather than a single function.

  • Compensatory Mechanisms: Bacteria often activate compensatory pathways when key proteins are absent, potentially masking the full impact of YciB loss.

  • Strain Background Effects: The genetic background can significantly influence ΔyciB phenotypes, necessitating consistent strain usage or complementation studies.

  • Growth Phase Considerations: YciB function may be more critical during specific growth phases, so phenotypes should be assessed across the growth curve.

The seemingly contradictory phenotypes (shorter cells upon deletion versus elongated cells during overexpression) actually provide complementary insights into YciB's role in coordinating cell division and elongation processes.

What bioinformatic approaches can identify conserved functional domains in YciB across bacterial species?

Several bioinformatic strategies can identify functional domains in YciB:

  • Multiple Sequence Alignment: Aligning YciB sequences across diverse bacterial species reveals conserved residues likely essential for function. For YciB, this approach has identified highly conserved transmembrane domains, suggesting structural constraints on its membrane topology.

  • Structural Prediction: Transmembrane topology prediction tools combined with newer protein structure prediction algorithms (like AlphaFold) can generate structural models of YciB to identify potential interaction surfaces.

  • Domain Architecture Analysis: Examining the organization of YciB's transmembrane domains across species can reveal structural elements that co-evolve with specific functions.

  • Genomic Context Analysis: Examining genes consistently located near yciB across diverse genomes can identify functional associations through operonic organization or co-regulation.

  • Phylogenetic Profiling: Correlating the presence/absence of YciB with other genes across bacterial genomes can identify proteins that function in the same pathway.

These approaches can be particularly valuable for understanding YciB's role in S. flexneri by leveraging the more extensive research on its E. coli homolog and identifying species-specific adaptations.

How can transcriptomic and proteomic data enhance understanding of YciB's role in cellular processes?

Multi-omics approaches provide systems-level insights into YciB function:

Omics ApproachApplication to YciB ResearchKey Insights
Transcriptomics (RNA-seq)Compare gene expression profiles between WT and ΔyciB strainsIdentify pathways dysregulated upon YciB loss, reveal compensatory responses
ProteomicsAnalyze protein abundance changes in ΔyciB mutantsDetect post-transcriptional effects, identify proteins stabilized or destabilized by YciB
Membrane proteomicsCompare membrane protein composition in WT vs. ΔyciBDetermine if YciB affects membrane protein insertion or stability
LipidomicsProfile membrane lipid composition in ΔyciB strainsTest hypothesis that YciB affects membrane fluidity through lipid composition
InteractomicsImmunoprecipitation coupled with mass spectrometryIdentify YciB interaction partners under different conditions

When analyzing these data, researchers should focus on:

  • Envelope stress response pathways, particularly Cpx and Rcs regulons that are activated in YciB-deficient E. coli .

  • Cell division and elongation genes, especially those encoding proteins whose localization is affected by YciB absence .

  • Lipoprotein processing and transport systems that may be compromised in ΔyciB mutants .

  • Differential effects across growth phases, as YciB function may vary throughout the cell cycle.

Integration of multiple omics datasets can distinguish direct from indirect effects of YciB deficiency and place YciB within the broader context of cellular processes.

What are the most promising approaches for investigating YciB's role in bacterial pathogenesis?

Several approaches show particular promise for elucidating YciB's role in Shigella pathogenesis:

  • Intracellular Replication Assays: Compare intracellular growth of wild-type and ΔyciB S. flexneri in epithelial cell infection models to determine if YciB affects bacterial survival and replication within host cells.

  • Cell-to-Cell Spread Analysis: Assess plaque formation in epithelial cell monolayers to quantify the impact of YciB on S. flexneri's ability to spread between adjacent cells, which is essential for dysentery production .

  • Host Response Profiling: Measure host inflammatory responses to wild-type versus ΔyciB mutants to determine if YciB affects pathogen-associated molecular pattern exposure.

  • In vivo Infection Models: Compare virulence of wild-type and ΔyciB mutants in animal models to assess YciB's contribution to pathogenesis under physiologically relevant conditions.

  • Conditional Expression Systems: Develop systems to modulate YciB levels during different infection stages to pinpoint when its function is most critical for pathogenesis.

Given that YciB (similar to its homolog IspA in S. flexneri) plays a role in intracellular spreading , these approaches may reveal new aspects of how cell division proteins contribute to bacterial virulence.

How might structural biology approaches advance understanding of YciB function?

Structural biology techniques could provide critical insights into YciB function:

TechniquePotential ApplicationsExpected Insights
Cryo-electron microscopyVisualize YciB within membrane contextMembrane organization, oligomeric state
X-ray crystallographyDetermine high-resolution structurePrecise arrangement of transmembrane helices
NMR spectroscopyExamine dynamic regions (e.g., cytoplasmic domains)Conformational changes during function
Hydrogen-deuterium exchange MSMap interaction surfacesRegions involved in protein-protein interactions
Cross-linking coupled with MSIdentify proximal proteins in vivoNative interaction partners in cellular context

The five transmembrane domains of YciB present both challenges and opportunities for structural studies. Understanding the three-dimensional arrangement of these domains could reveal how YciB influences membrane properties and interacts with division proteins. Particular attention should be paid to the cytoplasmic C-terminus and periplasmic N-terminus, as these regions may mediate specific protein interactions.

What potential exists for targeting YciB in antimicrobial development strategies?

YciB presents several characteristics that make it an interesting potential antimicrobial target:

  • Essential Synthetic Interactions: While yciB deletion alone is viable, its synthetic lethality with other genes (e.g., dcrB in E. coli, rodZ in S. flexneri) suggests that YciB inhibitors could be particularly effective when combined with compounds targeting these synthetic lethal partners.

  • Cell Division Role: YciB's involvement in proper localization of division proteins suggests that its inhibition could disrupt bacterial cell division, a proven antimicrobial strategy.

  • Membrane Integrity Function: YciB's role in maintaining cell envelope integrity means that inhibitors might increase bacterial susceptibility to existing antibiotics that target the cell envelope.

  • Species Specificity: While YciB is conserved across enterobacteria, there may be sufficient structural differences between species to develop selective inhibitors targeting pathogenic species.

  • Recombinant Vaccine Development: The successful expression of heterologous antigens in S. flexneri, as demonstrated with ETEC heat-labile enterotoxin B , suggests that engineered YciB variants could potentially serve as components of recombinant vaccines.

Researchers exploring YciB as an antimicrobial target should focus on identifying small molecules that disrupt specific YciB functions or protein-protein interactions rather than simply mimicking gene deletion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.