Recombinant Shigella flexneri serotype 5b Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB; SFV_0701; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTVH
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: sfv:SFV_0701

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant S. flexneri CrcB homolog protein?

Escherichia coli remains the preferred expression system for recombinant S. flexneri proteins due to their close genetic relationship. E. coli strain DH5α has been successfully used for plasmid construction and protein expression in S. flexneri studies . For membrane proteins like CrcB homolog, which typically functions as a fluoride ion channel, consider these approaches:

  • Use vectors with tunable promoters to prevent toxicity from overexpression

  • Express in E. coli strains optimized for membrane proteins (C41/C43 derivatives)

  • Growth at lower temperatures (30°C) to enhance proper folding

  • Addition of fusion tags (His, Myc) for purification and detection, as demonstrated with SodB protein in S. flexneri

How do growth conditions affect the expression and function of S. flexneri proteins?

Temperature critically affects both expression and virulence-associated functions of S. flexneri proteins. S. flexneri cultivated at 37°C exhibits virulent phenotypes including ability to penetrate and replicate in intestinal epithelial cells, while the same strain grown at 30°C is phenotypically avirulent and noninvasive . For optimal expression:

  • Media selection: LB broth for standard growth; TSA with Congo Red for virulence visualization

  • Temperature regulation: 37°C for virulence factor expression; 30°C for reduced virulence

  • Induction timing: Sequential induction can increase specific productivity by 1.6-fold

  • Supplementation: Addition of specific nutrients can enhance yield (e.g., 10 g/L N-acetylglucosamine increased glycoconjugate yield 3.1-fold)

  • Ion concentration: 10 mM Mg²⁺ has been determined optimal for certain protein modifications

What are the challenges in purifying membrane proteins like CrcB homolog from S. flexneri?

Membrane proteins present specific purification challenges compared to soluble proteins:

  • Detergent selection is critical: Start with mild detergents (DDM, LMNG) to maintain native structure

  • Two-step purification approach: Initial IMAC purification followed by size exclusion chromatography

  • Protein stability must be monitored throughout purification

  • Buffer optimization should include screening of pH, salt concentration, and stabilizing additives

  • Consider lipid nanodisc reconstitution for functional studies

For validation of oligomeric state, blue native PAGE has been successfully used to analyze S. flexneri protein complexes, as demonstrated in the identification of 53 homomultimeric and 9 heteromultimeric complexes .

How can protein complex formation of CrcB homolog be characterized in S. flexneri?

CrcB typically forms multimeric complexes as ion channels. The following approaches have proven effective for S. flexneri protein complex characterization:

  • Blue native PAGE separation of intact protein complexes directly from bacterial lysates

  • Mass spectrometry for component identification and stoichiometry determination

  • Comparative analysis between different temperature conditions (30°C vs 37°C) to assess temperature-dependent complex formation

  • Cross-validation with bioinformatics databases and homologous proteins from related species

Studies with SodB protein from S. flexneri demonstrated it exists as a ~66 kDa complex, which differs from the reported 43-kDa homodimer in E. coli, highlighting the importance of experimental validation across bacterial species .

What are the latest sequencing approaches for studying S. flexneri protein variants?

Whole genome sequencing (WGS) has revolutionized our understanding of S. flexneri protein diversity:

  • WGS can be completed within five working days of sample receipt for rapid analysis

  • Core genome phylogenetic analysis using tools like Parsnp allows identification of closely related strains

  • SNP analysis permits precise tracking of protein variants (a maximum of 20 core genome SNPs differences were observed among closely related isolates)

  • Comparative genomics facilitates identification of protein function variations across serotypes

For CrcB homolog research, WGS analysis could reveal natural variants that affect ion channel function and antimicrobial resistance patterns.

How does temperature affect protein complex abundance and function in S. flexneri?

Temperature has been shown to significantly impact protein complex abundance in S. flexneri:

  • Three protein complexes related to LPS synthesis (PyrB-PyrI, GlmS, and MglB) show temperature-dependent abundance

  • LPS is essential to S. flexneri virulence, creating a direct link between temperature, protein complex formation, and pathogenicity

  • Temperature shifts between environmental (30°C) and host body temperature (37°C) trigger adaptive changes in protein expression and complex formation

These findings suggest that CrcB homolog expression and complex formation should be examined at both temperatures to understand potential roles in environmental adaptation and host colonization.

What biochemical methods effectively distinguish between oligomeric states of S. flexneri membrane proteins?

To determine the oligomeric state of membrane proteins like CrcB homolog:

  • Chemical crosslinking followed by SDS-PAGE analysis

  • Blue native PAGE with appropriate detergent selection

  • Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS)

  • Analytical ultracentrifugation for precise molecular weight determination

  • Negative stain electron microscopy for visual confirmation of complex formation

Table 1: Comparison of Methods for Membrane Protein Oligomeric State Determination

MethodResolutionSample RequirementAdvantagesLimitations
Crosslinking + SDS-PAGELow10-50 μgSimple, accessibleArtificial aggregation
Blue Native PAGEMedium5-20 μgMaintains native stateDetergent interference
SEC-MALSHigh100-200 μgPrecise MW determinationRequires specialized equipment
Analytical UltracentrifugationVery High50-100 μgGold standard accuracyTime-consuming, expensive
Negative Stain EMMedium-High5-10 μgVisual confirmationSample preparation artifacts

What parameters should be optimized for recombinant glycoprotein production in S. flexneri?

For studies requiring glycosylated forms of recombinant proteins:

What immunological assays are most informative for studying immune responses to S. flexneri proteins?

Based on established research on S. flexneri immunology:

  • Antibody-secreting cell (ASC) responses analysis using ELISPOT assays have successfully quantified mucosal immune responses (100% responder rate with 71-239 geometric mean ASCs per 10⁶ PBMCs)

  • Serum antibody measurements against specific antigens (anti-Ipa antibodies show increasing seroprevalence with age in endemic areas)

  • Cytokine production profiling from patient samples revealed increased IFN-γ in plasma and stool, suggesting TH1-type responses

  • T-cell phenotyping showed increased proportions of memory T cells (CD45RO⁺) and expression of activation molecules (CD25, CD38, HLA-DR, CD54)

Table 2: Critical Immunological Responses to Wild-type S. flexneri

ChallengeDiarrheaDysenteryFeverIgA anti-O-antigen ASC Response RateGeometric Mean ASCs*
Challenge no. 186%71%71%100%71
Challenge no. 292%83%83%92%239
*Per 10⁶ PBMCs (peripheral blood mononuclear cells)

How should experiments be designed to assess temperature-dependent regulation of CrcB homolog in S. flexneri?

Design considerations for temperature-dependency studies:

  • Parallel cultures at 30°C and 37°C with identical media and growth phase sampling

  • Quantitative RT-PCR to measure transcriptional changes

  • Proteomic analysis using both soluble and membrane fraction preparations

  • Functional assays measuring ion channel activity at both temperatures

  • Structural analysis to detect temperature-induced conformational changes

This approach mimics established protocols that revealed temperature-dependent regulation of virulence factors in S. flexneri, where growth at 37°C but not 30°C resulted in keratoconjunctivitis in guinea pigs and epithelial cell invasion .

What controls are essential when studying recombinant S. flexneri proteins expressed in E. coli?

Critical experimental controls include:

  • Expression of the same protein in both S. flexneri and E. coli to identify host-specific differences

  • Empty vector controls to account for host response to expression system

  • Wild-type vs. tagged protein comparisons to ensure tag doesn't alter function

  • Temperature controls (30°C vs. 37°C) to account for temperature-dependent expression patterns

  • Comparative analysis with known homologs from related species

The importance of these controls was demonstrated in a study of SodB protein, where Myc-tagged versions were expressed in both S. flexneri and E. coli to resolve apparent molecular weight discrepancies between species .

How can functional assays be developed for CrcB homolog ion channel activity?

Suggested approaches for functional characterization:

  • Fluoride sensitivity assays comparing wild-type and CrcB-knockout strains

  • Liposome reconstitution with purified protein for ion flux measurements

  • Patch-clamp electrophysiology for single-channel conductance determination

  • Isothermal titration calorimetry for ion binding affinity measurements

  • Fluorescent ion indicators for real-time flux visualization in whole cells

How should researchers interpret heterogeneity in recombinant membrane protein preparations from S. flexneri?

Membrane protein heterogeneity can arise from multiple factors:

  • Incomplete solubilization resulting in various oligomeric states

  • Post-translational modifications affecting migration patterns

  • Lipid composition differences altering protein-detergent complex properties

  • Uneven detergent binding causing anomalous migration on gels

Interpretation requires multiple complementary techniques and careful attention to sample preparation conditions. When analyzing S. flexneri protein complexes, researchers found apparent discrepancies between observed and theoretical molecular weights that were resolved through additional experimental verification .

What bioinformatic approaches are most useful for analyzing S. flexneri CrcB homolog sequence variation?

Recommended bioinformatic pipelines include:

  • Multiple sequence alignment with CrcB homologs from diverse bacteria

  • Transmembrane topology prediction using specialized tools (TMHMM, Phobius)

  • Homology modeling based on available CrcB structures

  • Conservation analysis to identify functionally critical residues

  • Molecular dynamics simulations to investigate ion permeation mechanisms

Whole genome sequencing approaches have been successfully applied to analyze S. flexneri isolates, with core genome phylogenetic analysis techniques applicable to protein-specific investigations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.