Recombinant Shigella flexneri serotype 5b Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Shigella Biology

GlpG mediates quality control of orphan membrane proteins by cleaving exposed transmembrane domains (TMDs) not incorporated into functional complexes . Key findings:

  • Substrate Specificity: Targets TMDs of respiratory complex subunits (e.g., HybA, HybO, FdoH) but spares those integrated into functional complexes .

  • Mechanism: Initial cleavage by GlpG enables subsequent degradation of misfolded proteins, preventing cytotoxic accumulation .

  • Virulence Independence: Deletion of glpG and rhom7 (a paralog) does not impair Shigella virulence, oxidative stress resistance, or type III secretion .

3.1. Expression Systems

Produced in E. coli or Shigella vectors with codon optimization for high-yield soluble expression .

3.2. Research Applications

ApplicationUtility
Enzymatic AssaysMeasures cleavage kinetics of synthetic substrates (e.g., TatA-TMD)
Structural StudiesX-ray crystallography to resolve substrate-binding pockets
Drug DiscoveryScreens for rhomboid protease inhibitors targeting bacterial pathogens

Comparative Genomics and Serotype Specificity

S. flexneri 5b GlpG shares 98% sequence identity with S. flexneri 2a GlpG, but serotype-specific O-antigen modifications (e.g., glucosylation) influence host immune evasion . The glpG gene (locus SFV_3431) is chromosomally encoded and conserved across Shigella spp., suggesting evolutionary stability .

Key Research Findings

  • Protection Mechanism: Hyd-2 complex incorporation shields HybA TMDs from GlpG cleavage, while orphan HybA is rapidly degraded .

  • Catalytic Efficiency: GlpG exhibits a substrate turnover rate of ~0.1 s⁻¹, driven by TMD accessibility rather than enzyme-substrate affinity .

  • Biotechnological Use: Recombinant GlpG is critical for studying intramembrane proteolysis in Gram-negative pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
glpG; SFV_3431; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWLAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: sfv:SFV_3431

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella flexneri serotype 5b Rhomboid protease glpG and what is its significance in bacterial biology?

Shigella flexneri serotype 5b Rhomboid protease glpG is an intramembrane serine protease (EC 3.4.21.105) belonging to the rhomboid family of proteases. The protein is encoded by the glpG gene (locus SFV_3431 in S. flexneri serotype 5b strain 8401) and consists of 276 amino acids . Rhomboid proteases are widespread and form the largest superfamily of intramembrane proteases, playing crucial roles across all domains of life .

In bacterial biology, glpG is particularly significant as it participates in membrane protein quality control by targeting specific components of respiratory complexes. When these components fail to incorporate into their respective functional complexes (becoming "orphan" proteins), they are recognized and cleaved by rhomboid proteases like glpG, thus protecting cells from the potentially damaging effects of these orphan proteins . This quality control mechanism represents a fundamental aspect of bacterial membrane homeostasis.

How does the structure of Shigella flexneri glpG compare to other bacterial rhomboid proteases?

Shigella flexneri glpG shares 99% amino acid identity with the prototypical rhomboid protease GlpG from Escherichia coli, which has been extensively characterized structurally . The core structure consists of six transmembrane helices (6-TM), which form the basic functional unit found in bacterial rhomboids .

Unlike some bacterial rhomboids like E. coli GlpG (ecGlpG) that possess a cytoplasmic domain in addition to the 6-TM core, Shigella glpG represents the minimal functional unit of rhomboid proteases. This differs from eukaryotic secretory rhomboids like AarA, which typically have seven predicted transmembrane domains . The catalytic dyad in bacterial rhomboids, including Shigella flexneri glpG, consists of Ser201 and His254, with the serine residue embedded approximately 10 Å below the membrane surface .

What is the relationship between Shigella flexneri and dysentery, and how might glpG relate to pathogenesis?

Shigella flexneri is one of the bacterial species that causes bacillary dysentery, a severe form of diarrheal disease . Along with other Shigella species like S. sonnei and S. boydii, S. flexneri can cause bloody diarrhea through invasion of the intestinal epithelium . S. flexneri colonizes the anaerobic environment of the large intestine and invades epithelial cells using its type three secretion system (T3SS) .

While the direct role of glpG in Shigella pathogenesis has not been fully elucidated, its function in membrane protein quality control may contribute to bacterial fitness during infection. Proper assembly of membrane complexes, including those involved in respiration and environmental adaptation, is crucial for bacterial survival within host environments. By ensuring that orphan membrane proteins are eliminated, glpG might indirectly support pathogenesis by maintaining membrane integrity and function under the stressful conditions encountered during infection .

What are the optimal experimental conditions for assessing glpG proteolytic activity and performing kinetic analyses?

To assess glpG proteolytic activity, researchers typically use gel-based cleavage assays with specific substrate proteins. Based on protocols used for similar rhomboid proteases, the following conditions are recommended:

Reaction mixture composition:

  • Buffer: 50 mM 2-(n-Mopholino)ethanesulfonic acid (MES) pH 6.0

  • Salt: 150 mM NaCl

  • Stabilizer: 20% glycerol

  • Detergent: 0.1% DDM (n-dodecyl-β-D-maltopyranoside) or 0.2% DM (n-decyl-β-D-maltopyranoside)

  • Enzyme concentration: 0.13-0.33 μM (depending on the specific rhomboid)

  • Substrate concentration range: 0.5-15 μM

Experimental procedure:

  • Optimize enzyme concentration to ensure linear product formation over time

  • Incubate reaction mixtures at 37°C for 15 minutes to 4 hours, depending on enzyme activity

  • Stop reactions by adding SDS-sample buffer

  • Analyze samples using SDS-Tricine gels for better resolution of proteins smaller than 30 kDa

  • Detect cleaved products via Western blot using appropriate antibodies (e.g., anti-His if substrates contain a His-tag)

  • Quantify substrate cleavage by densitometry, integrating the cleaved product band intensity

  • Normalize values to full-length substrate levels

  • Calculate kinetic parameters using both Michaelis-Menten and Hill equations to determine best fit

For rigorous kinetic analysis, ensure that initial rate conditions are maintained throughout the assay by confirming a linear relationship between time and product formation. Controls should include substrate without enzyme to check for spontaneous degradation.

What substrate specificity does glpG exhibit, and how can researchers identify and validate novel substrates?

Rhomboid proteases like glpG exhibit specific substrate recognition patterns centered on transmembrane domain (TMD) properties rather than strict sequence specificity. For Shigella sonnei GlpG (which shares 99% identity with S. flexneri glpG), known natural substrates include HybA and FdoH, which are components of respiratory complexes .

Strategies for identifying and validating novel substrates:

  • Artificial substrate screening:

    • Construct artificial substrates containing test TMDs fused to reporter domains (e.g., MBP-3xFLAG-TMD-Trx constructs)

    • Express these constructs in bacteria expressing wild-type or catalytically inactive glpG

    • Detect cleavage by Western blot analysis using antibodies against the reporter tags

  • Proteomics-based approaches:

    • Compare membrane proteome profiles between wild-type and glpG knockout strains

    • Look for proteins that accumulate in the knockout strain, indicating potential substrates

    • Validate candidates by in vitro cleavage assays with purified components

  • TMD analysis criteria:

    • Focus on proteins with metastable TMDs that might become exposed when not incorporated into complexes

    • Key features include helix-destabilizing residues (glycine, proline) and polar amino acids within the TMD

    • Assess TMD dynamics using molecular dynamics simulations

  • Validation experiments:

    • Express candidate substrates with and without their normal complex partners

    • Demonstrate protection from cleavage when incorporated into the complex

    • Confirm direct cleavage using purified components in reconstituted systems

    • Perform site-directed mutagenesis to identify critical residues for recognition

How does allosteric regulation affect glpG proteolytic activity and what experimental approaches can assess this regulation?

Rhomboid proteases, including bacterial glpG, exhibit cooperative kinetics in substrate cleavage, suggesting allosteric regulation of their activity. This is evidenced by the better fit of Hill's equation compared to Michaelis-Menten kinetics for describing rhomboid-mediated proteolysis .

Key aspects of allosteric regulation:

  • Hill coefficient analysis:

    • Hill coefficients (nH) greater than 1 indicate positive cooperativity

    • For rhomboid proteases like hiGlpG, ecGlpG, and AarA, the Hill coefficients when cleaving psTatA substrate range from 1.62 to 2.40, confirming cooperativity

  • Structural changes during substrate binding:

    • Formation of an initial "interrogation complex" when substrate TMD engages glpG

    • Subsequent conformational changes that expose the catalytic site

    • Rate-driven process rather than affinity-driven, with enzyme-substrate affinity playing a minor role

Experimental approaches to study allosteric regulation:

  • Enzyme kinetics:

    • Compare fits of reaction velocity data to Michaelis-Menten versus Hill equations

    • Calculate apparent KM (K0.5), Vmax, and Hill coefficients

    • Analyze how these parameters change with different substrates or conditions

  • Mutagenesis studies:

    • Introduce mutations in regions suspected to be involved in allosteric communication

    • Assess how these mutations affect cooperativity (Hill coefficient)

    • Identify residues that alter catalytic efficiency without affecting substrate binding

  • Small molecule modulators:

    • Test effects of potential allosteric modulators on enzyme kinetics

    • Look for changes in Hill coefficient rather than just inhibition of activity

    • Characterize binding sites using competitive binding assays

  • Structural biology approaches:

    • Use hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics upon substrate binding

    • Compare crystal structures of enzyme in different states to identify conformational changes

    • Apply molecular dynamics simulations to model allosteric communication networks

What approaches can be used to generate and characterize glpG knockouts, and how do these mutations affect bacterial physiology?

Generating and characterizing glpG knockouts allows researchers to understand the physiological importance of this rhomboid protease in bacterial cells. Several approaches are available:

Generation of glpG knockouts:

  • PCR-mediated allelic replacement:

    • Design PCR primers to amplify a resistance cassette with flanking homology to regions around glpG

    • Target disruption at position 67 of the 276-amino-acid protein (based on known inactivating insertions)

    • Transform bacteria expressing recombination systems (e.g., λ Red system) with the PCR product

    • Select transformants on appropriate antibiotic media

    • Verify the glpG::cat allele by PCR

  • CRISPR-Cas9 based methods:

    • Design guide RNAs targeting glpG

    • Include homology-directed repair templates with selection markers

    • Isolate and verify mutants by sequencing

Phenotypic characterization:

  • Growth analysis:

    • Compare growth of wild-type and ΔglpG mutants in complete and minimal media

    • Test growth under both aerobic and anaerobic conditions

    • Analyze growth kinetics using automated systems like Biolog MicroPlates

  • Membrane proteome analysis:

    • Compare membrane protein profiles between wild-type and mutant strains

    • Look for accumulation of potential substrates in the absence of glpG

    • Identify changes in membrane complex assembly and stability

  • Stress response assessment:

    • Test sensitivity to various stressors (oxidative stress, heat shock, membrane stress)

    • Evaluate membrane integrity using dye penetration assays

    • Assess changes in metabolic pathways, particularly those involving membrane complexes

  • Complementation studies:

    • Reintroduce wild-type glpG or mutant versions to confirm phenotype specificity

    • Use controlled expression systems to analyze dose-dependent effects

How can GMMA (Generalized Modules for Membrane Antigens) technology be utilized in studies of glpG and bacterial membrane proteins?

GMMA (Generalized Modules for Membrane Antigens) are exosomes released from engineered Gram-negative bacteria and represent an innovative platform for studying membrane proteins like glpG in a near-native membrane environment. This technology can be particularly valuable for functional and structural studies of membrane proteins that are difficult to express and purify using conventional methods.

GMMA production and engineering:

  • Generation of GMMA-producing strains:

    • Engineer bacteria by deleting the tolR gene, which leads to increased outer membrane blebbing

    • Modify genetic background as needed (e.g., converting to desired serotypes)

    • Express proteins of interest in the modified background

  • GMMA purification:

    • Collect culture supernatants containing released GMMA

    • Remove bacteria by filtration or low-speed centrifugation

    • Concentrate GMMA by ultracentrifugation or tangential flow filtration

    • Further purify using density gradient centrifugation if needed

Applications for glpG studies:

  • Functional analysis:

    • Express wild-type or mutant glpG in GMMA-producing strains

    • Co-express potential substrates to study cleavage in a membrane context

    • Analyze protease activity directly in isolated GMMA vesicles

  • Structural characterization:

    • Use GMMA to obtain glpG in a native-like membrane environment

    • Apply techniques like cryo-electron microscopy to GMMA containing glpG

    • Study protein-protein interactions within the membrane context

  • High-throughput screening:

    • Generate libraries of GMMA containing variant forms of glpG

    • Screen for altered activity, specificity, or regulation

    • Use as a platform for substrate identification

  • Experimental validation:
    The feasibility of GMMA-based approaches has been demonstrated in studies with Shigella, where GMMA displaying different O-antigen structures were successfully produced by engineering a scaffold strain with various modifying enzymes .

Table 1: Comparison of Key Properties of Bacterial Rhomboid Proteases

PropertyS. flexneri glpGE. coli GlpG (ecGlpG)AarA
Transmembrane topology6 TM core6 TM core + cytoplasmic domain7 TM domains
Catalytic residuesSer201, His254Ser201, His254Ser150, His254
Known substratesHybA, FdoHSimilar to S. sonnei GlpGVaried
Hill coefficient (nH)Not specified1.62-2.401.62-2.40
Kinetic behaviorCooperativeCooperativeCooperative
Optimal reaction pH~6.0~6.0~6.0
Detergent compatibilityDDM, DMDDM, DMDDM

Data compiled from references

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.