Recombinant Shigella flexneri serotype 5b sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

UgpA is a transmembrane permease component of the ATP-binding cassette (ABC) transporter system responsible for sn-glycerol-3-phosphate (G3P) uptake in S. flexneri serotype 5b . This protein facilitates the transport of G3P across the bacterial membrane, a process essential for phospholipid biosynthesis and carbon metabolism under phosphate-limiting conditions .

Key FeaturesDetails
Gene NameugpA (locus: SFV_3455)
Protein Length295 amino acids (full-length)
OrganismShigella flexneri serotype 5b (strain 8401)
Associated Transport Systemsn-Glycerol-3-phosphate ABC transporter

Recombinant Production

The protein is typically expressed in Escherichia coli with an N-terminal His tag for purification .

Vaccine Development

  • UgpA is explored as a candidate antigen for Shigella vaccines due to its surface accessibility and role in virulence .

  • Example: Recombinant S. flexneri strains expressing heterologous antigens (e.g., ETEC’s LTB) leverage UgpA-like permeases for stable antigen display .

Antibiotic Resistance Studies

  • Comparative genomic studies link ugpA expression to biofilm formation and antibiotic susceptibility patterns in S. flexneri serotypes .

Research Findings

  • Genomic Stability: ugpA is retained in S. flexneri 5b despite extensive genomic rearrangements in other serotypes, suggesting its essential metabolic role .

  • Serotype-Specific Modifications: Unlike serotype 2a, S. flexneri 5b lacks glucosylation genes that alter O-antigen structure, potentially affecting vaccine cross-reactivity .

  • Functional Redundancy: Deletion studies indicate compensatory mechanisms in G3P transport, highlighting UgpA’s non-essential but optimized role in nutrient uptake .

Future Directions

  • Therapeutic Targeting: UgpA’s role in biofilm formation and antibiotic resistance warrants exploration as a drug target .

  • Multivalent Vaccines: Engineering UgpA into OMVs (outer membrane vesicles) could enhance immune responses against Shigella and ETEC co-infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ugpA; SFV_3455; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
ugpA
Target Protein Sequence
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV TLFHDSYYLDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG GPVQATTTLIYKIYREGFTGLDLASSAAQSMVLMFLVIVLTVVQFRYVESKVRYQ
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: sfv:SFV_3455

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do I express and purify recombinant ugpA protein from Shigella flexneri serotype 5b?

The expression and purification of recombinant ugpA requires specialized techniques due to its nature as a membrane protein. The recommended methodology involves:

  • Cloning the ugpA gene from Shigella flexneri serotype 5b genomic DNA using PCR with high-fidelity polymerase

  • Inserting the gene into an expression vector with an appropriate tag (commonly His-tag) for purification

  • Transforming the construct into an appropriate E. coli expression strain

  • Inducing protein expression under optimized conditions (temperature, inducer concentration, time)

  • Extracting the membrane fraction using differential centrifugation

  • Solubilizing the membrane proteins with appropriate detergents

  • Purifying using affinity chromatography followed by size exclusion chromatography

For optimal results, expression systems such as E. coli BL21(DE3) with vectors containing T7 promoters are frequently used. The expressed protein is commonly fused to an N-terminal His-tag for purification purposes, as observed in commercially available preparations .

What serotyping methods are available for confirming Shigella flexneri serotype 5b identification?

Shigella flexneri can be serotyped using both phenotypic and genotypic methods. The methodological approaches include:

Phenotypic serotyping:

  • Uses antisera raised against type-specific somatic antigens and group factor antigens

  • Involves slide agglutination tests with commercially available antisera

  • Requires skilled technicians to interpret often subjective results

Genotypic serotyping:

  • Employs PCR targeting O-antigen synthesis or modification genes

  • Can be performed using conventional PCR or real-time PCR formats

  • Provides more objective results based on genetic determinants

A comprehensive evaluation of 244 S. flexneri isolates found 92.6% concordance between phenotypic serotyping and PCR-based methods . For discrepant results, whole-genome sequencing (WGS) provides resolution by identifying mutations in O-antigen genes that may affect phenotypic expression while confirming genetic serotype .

When specifically confirming serotype 5b, researchers should employ both methods, as insertions/deletions or point mutations in O-antigen synthesis genes can lead to discrepancies between phenotypic and genotypic results .

How can I design experiments to determine the structure-function relationship of ugpA in Shigella flexneri serotype 5b?

Designing experiments to elucidate structure-function relationships of ugpA requires a multi-faceted approach combining computational, biochemical, and genetic techniques:

Computational analysis:

  • Perform homology modeling based on known structures of related membrane transporters

  • Use molecular dynamics simulations to predict critical residues in substrate binding and translocation

  • Identify conserved domains through multiple sequence alignments across bacterial species

Targeted mutagenesis:

  • Create a library of site-directed mutants focusing on predicted functional residues

  • Express mutant proteins in ugpA-knockout strains

  • Assess functionality through complementation assays and transport studies

Biochemical characterization:

  • Purify wild-type and mutant proteins using affinity chromatography

  • Perform substrate binding assays to determine binding constants

  • Conduct reconstitution experiments in proteoliposomes to assess transport kinetics

This methodological framework allows for systematic mapping of functional domains and identification of critical residues involved in substrate recognition, binding, and translocation across the membrane.

What are the best approaches for analyzing contradictory results between phenotypic and genotypic serotyping of Shigella flexneri?

When faced with contradictory results between phenotypic and genotypic serotyping of Shigella flexneri, researchers should employ a systematic troubleshooting approach:

  • Verify phenotypic serotyping by:

    • Repeating tests with fresh cultures and quality-controlled antisera

    • Having multiple trained technicians independently assess agglutination reactions

    • Testing with extended panels of antisera to detect cross-reactions

  • Validate genotypic serotyping by:

    • Sequencing PCR products to confirm target specificity

    • Employing alternative primer sets targeting different regions of serotype-determining genes

    • Using multiple PCR-based approaches (conventional, multiplex, real-time)

  • Resolve discrepancies through whole-genome sequencing:

    • Analyze the entire O-antigen gene cluster for mutations, insertions, or deletions

    • Identify novel genotypes or hybrid serotypes

    • Compare with reference genomes of established serotypes

Research has shown that discrepancies often result from:

  • Insertions/deletions or point mutations in O-antigen synthesis or modification genes affecting protein function

  • Nonspecific cross-reactions in phenotypic testing

  • Novel genotypes not covered by existing typing schemes

WGS analysis has revealed that serotype, whether determined phenotypically or genotypically, is a relatively weak predictor of phylogenetic relationships among S. flexneri strains, suggesting that serotyping should be complemented with more discriminatory approaches like SNP analysis for epidemiological investigations .

How can I develop a recombinant Shigella flexneri strain expressing heterologous antigens while maintaining ugpA functionality?

Developing recombinant Shigella flexneri strains expressing heterologous antigens while preserving ugpA functionality requires careful genetic engineering to avoid disrupting essential transport functions. The methodological approach includes:

  • Genomic integration site selection:

    • Choose neutral sites in the genome that do not affect essential functions

    • Avoid disrupting operons containing ugpA or related transport genes

    • Consider using intergenic regions with minimal regulatory elements

  • Expression system design:

    • Select promoters with appropriate strength and regulation

    • Consider inducible systems if the heterologous antigen might affect bacterial fitness

    • Include transcriptional terminators to prevent read-through effects on downstream genes

  • Verification of ugpA functionality:

    • Measure growth in media where glycerol-3-phosphate transport is essential

    • Directly assess transport activity using radiolabeled substrates

    • Perform complementation studies if necessary

Recent research has demonstrated successful development of recombinant S. flexneri expressing heterologous antigens. For example, a recombinant strain was engineered to express the heat-labile enterotoxin B (LTB) subunit from enterotoxigenic E. coli (ETEC) by incorporating the eltb gene directly into Shigella's genome . This approach enhanced stability and consistent production of the heterologous protein while maintaining essential Shigella functions .

What analytical methods are most effective for characterizing outer membrane vesicles (OMVs) containing ugpA from recombinant Shigella flexneri?

Characterizing outer membrane vesicles (OMVs) containing ugpA from recombinant Shigella flexneri requires a comprehensive analytical approach:

Physical characterization:

  • Dynamic light scattering (DLS) for size distribution analysis

  • Nanoparticle tracking analysis (NTA) for concentration and size measurements

  • Electron microscopy (TEM/SEM) for morphological assessment

Protein composition analysis:

  • SDS-PAGE followed by western blotting with anti-ugpA antibodies

  • Proteomic analysis using LC-MS/MS to identify and quantify all proteins

  • Immunoblotting to confirm the presence of specific Shigella antigens

Functional assessment:

  • In vitro binding assays to evaluate interactions with host cell receptors

  • Cell culture studies to assess internalization and immune activation

  • Immunogenicity studies in animal models if OMVs are intended for vaccine development

Proteomic analysis is particularly valuable, as demonstrated in recent research where LC-MS/MS confirmed that isolated vesicles from recombinant Shigella strains contained not only the heterologous protein but also main outer membrane proteins and virulence factors including OmpA, OmpC, IcsA, SepA, and Ipa proteins .

What quasi-experimental study designs are most appropriate for evaluating ugpA-based vaccine candidates?

When evaluating ugpA-based vaccine candidates, selecting an appropriate quasi-experimental study design is crucial, especially when randomized controlled trials are not feasible. The following hierarchy of designs offers increasingly robust evidence:

Designs without control groups:

  • One-group posttest-only design (X O₁): Measures immune response after vaccination only

  • One-group pretest-posttest design (O₁ X O₂): Measures immune response before and after vaccination

  • One-group pretest-posttest design with double pretest (O₁ O₂ X O₃): Adds a second baseline measurement for better control

Designs with control groups:

  • Untreated control group with dependent pretest and posttest samples:

    • Intervention group: O₁ₐ X O₂ₐ

    • Control group: O₁ᵦ O₂ᵦ

  • Untreated control group with switching replications:

    • Intervention group: O₁ₐ X O₂ₐ O₃ₐ

    • Control group: O₁ᵦ O₂ᵦ X O₃ᵦ

    • This design allows both groups to eventually receive the vaccine

Interrupted time-series designs:

  • Multiple pretest and posttest observations: O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀

  • Provides robust evidence of intervention effects over time

Higher-level designs (with control groups and multiple measurements) provide more convincing evidence for causal links between interventions and outcomes . For vaccine candidates, interrupted time-series designs are particularly valuable for assessing duration of immunity and booster effects.

How can I optimize the expression conditions for recombinant ugpA protein to maximize yield and functionality?

Optimizing expression conditions for recombinant ugpA requires systematic evaluation of multiple parameters to maximize both yield and functionality of this membrane protein:

Expression system optimization:

  • Host strain selection:

    • Compare E. coli strains (BL21(DE3), C41(DE3), C43(DE3))

    • Consider specialized strains for membrane proteins

    • Test Shigella-based expression systems for native processing

  • Vector and promoter selection:

    • Evaluate inducible (T7, tac) versus constitutive promoters

    • Test fusion tags (His, GST, MBP) for effects on folding and stability

    • Consider dual tagging for detection and purification

Growth and induction parameters:

  • Create a factorial design experiment varying:

    • Temperature (15°C, 25°C, 30°C, 37°C)

    • Inducer concentration (e.g., IPTG: 0.1, 0.5, 1.0 mM)

    • Induction time (4h, 8h, overnight)

    • Growth media (LB, TB, auto-induction media)

Membrane extraction optimization:

  • Compare detergents for solubilization:

    • Mild detergents (DDM, LMNG, CHAPS)

    • Evaluate different concentrations and solubilization times

    • Consider nanodiscs or amphipols for maintaining functionality

Functionality assessment:

  • Develop assays to verify proper folding:

    • Circular dichroism for secondary structure

    • Substrate binding assays

    • Reconstitution into proteoliposomes for transport studies

For His-tagged recombinant ugpA, optimal conditions often include expression in C41(DE3) at lower temperatures (18-25°C) with moderate inducer concentrations and extended induction times to allow proper membrane insertion and folding .

What statistical methods should be employed for analyzing serotyping data from multiple methodologies?

When analyzing serotyping data from multiple methodologies (phenotypic, PCR-based, and WGS), appropriate statistical methods are crucial for meaningful interpretation:

Concordance analysis:

  • Calculate percent agreement between methods

  • Determine Cohen's kappa coefficient to account for chance agreement

  • Use McNemar's test to assess systematic differences between methods

Discrepancy analysis:

  • Create contingency tables categorizing types of discrepancies

  • Apply chi-square tests to identify patterns in disagreement

  • Perform logistic regression to identify predictors of discordant results

Performance metrics calculation:

  • Using WGS as the gold standard, calculate:

    • Sensitivity, specificity, and predictive values for each method

    • Area under the ROC curve for quantitative assays

    • Likelihood ratios for positive and negative results

Multivariate analysis:

  • Principal component analysis to visualize clustering of methods

  • Hierarchical clustering to identify related serotypes

  • Multiple correspondence analysis for categorical data comparison

In a comprehensive evaluation of S. flexneri serotyping methods, researchers found 92.6% concordance between phenotypic and PCR-based methods across 244 isolates . When discrepancies occurred, whole-genome sequencing provided resolution by identifying genetic mutations affecting phenotypic expression. This analytical approach enabled researchers to classify discrepancies into specific categories: insertions/deletions, point mutations, cross-reactions, and novel genotypes .

How can I analyze growth trajectory data to evaluate the impact of ugpA mutations on Shigella flexneri fitness?

Analyzing growth trajectory data to evaluate ugpA mutation effects requires sophisticated statistical approaches that go beyond simple endpoint comparisons:

Growth curve parametrization:

  • Fit growth curves to established models:

    • Gompertz function

    • Logistic equation

    • Baranyi model

  • Extract key parameters:

    • Lag phase duration

    • Maximum growth rate

    • Maximum population density

    • Area under the curve

Statistical comparison methods:

  • For comparing single parameters:

    • ANOVA with post-hoc tests for multiple strain comparisons

    • Mixed-effects models to account for experimental batches

    • Non-parametric alternatives for non-normally distributed data

  • For comparing entire growth curves:

    • Functional data analysis

    • Principal component analysis of growth parameters

    • Permutation tests for curve differences

Visualizing fitness differences:

  • Create heat maps of growth parameters across different media conditions

  • Generate fitness landscapes showing interaction effects between mutations and environmental conditions

  • Develop radar plots displaying multiple fitness parameters simultaneously

This methodological framework allows quantitative assessment of how ugpA mutations affect different aspects of bacterial growth and provides a more comprehensive picture of fitness effects than simple endpoint measurements.

What bioinformatic approaches can help identify functional domains within the ugpA protein sequence?

Identifying functional domains within the ugpA protein requires an integrated bioinformatic approach:

Sequence-based analysis:

  • Multiple sequence alignment with homologous proteins:

    • Use tools like Clustal Omega, MUSCLE, or T-Coffee

    • Include ugpA sequences from diverse bacterial species

    • Identify conserved residues and motifs across species

  • Domain prediction:

    • Search against domain databases (Pfam, SMART, CDD)

    • Apply hidden Markov models for domain identification

    • Use sliding window conservation analysis to detect functional regions

Structural prediction:

  • Transmembrane topology prediction:

    • TMHMM, HMMTOP, or Phobius for identifying membrane-spanning regions

    • SignalP for signal peptide prediction

    • TOPCONS for consensus topology prediction

  • 3D structure modeling:

    • Homology modeling based on related transporters with known structures

    • Threading approaches for fold recognition

    • Ab initio modeling for unique domains

Functional site prediction:

  • Identify putative substrate binding sites:

    • ConSurf for evolutionary conservation mapping

    • 3DLigandSite for binding pocket prediction

    • COACH for ligand binding site prediction

  • Protein-protein interaction sites:

    • SPPIDER for prediction of interaction interfaces

    • PrePPI for prediction of protein-protein interactions

    • Molecular docking to test interactions with partner proteins

This comprehensive bioinformatic pipeline allows researchers to generate testable hypotheses about structure-function relationships in ugpA that can guide subsequent experimental investigations.

How do I interpret table-based analytics when comparing different recombinant Shigella flexneri strains expressing ugpA variants?

When comparing recombinant Shigella flexneri strains expressing ugpA variants, table-based analytics provide a structured approach for data interpretation:

Data organization strategy:

  • Create matrices with strains as rows and measured parameters as columns

  • Normalize data appropriately for each parameter type

  • Apply conditional formatting to highlight significant differences

  • Include statistical significance indicators

Comparative analysis approaches:

  • For protein expression analysis:

    • Compare relative expression levels across strains

    • Assess correlation between expression level and functional parameters

    • Create expression ratio tables normalizing to wild-type

  • For functional assays:

    • Calculate percent activity relative to wild-type

    • Determine EC50 or IC50 values for dose-response relationships

    • Compare kinetic parameters (Km, Vmax) for transport assays

Visualization methods:

  • Transform tabular data into graphical representations:

    • Heat maps for multivariate comparisons

    • Bar charts for single parameter comparisons

    • Radar charts for multidimensional functional profiles

  • Progressive filtering:

    • Apply increasingly stringent filters to identify variants with desired properties

    • Create decision trees for variant classification

    • Use principal component analysis to reduce dimensionality and identify key determinants

For example, when analyzing protein expression levels in outer membrane vesicles, researchers might create tables comparing the relative abundance of ugpA variants with other membrane proteins and virulence factors across different strains, similar to the proteomic analysis approach used in recent studies of recombinant Shigella strains .

What are common challenges in recombinant ugpA expression and how can they be overcome?

Expressing recombinant membrane proteins like ugpA presents several challenges that require specific troubleshooting approaches:

Low expression levels:

  • Problem: Toxic effects on host cells due to membrane protein overexpression
    Solution: Use tightly regulated expression systems, lower induction temperatures (16-25°C), and specialized host strains (C41/C43)

  • Problem: Poor translation efficiency due to rare codons
    Solution: Use codon-optimized sequences or hosts containing extra tRNA genes (e.g., Rosetta strains)

Inclusion body formation:

  • Problem: Improper folding leading to aggregation
    Solution:

    • Express as fusion with solubility-enhancing tags (MBP, NusA)

    • Add chemical chaperones to growth media (glycerol, betaine)

    • Explore refolding protocols from solubilized inclusion bodies

Protein degradation:

  • Problem: Proteolytic degradation of expressed protein
    Solution:

    • Use protease-deficient host strains

    • Add protease inhibitors during extraction

    • Optimize extraction buffers to maintain protein stability

Poor solubilization:

  • Problem: Inefficient extraction from membranes
    Solution:

    • Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations

    • Extend solubilization time at controlled temperature

    • Consider alternative solubilization methods (SMALPs, nanodiscs)

Functionality assessment:

  • Problem: Difficult to confirm proper folding and function
    Solution:

    • Develop ligand binding assays compatible with detergent-solubilized protein

    • Reconstitute into proteoliposomes for transport studies

    • Use thermal stability assays as proxy for proper folding

These methodological solutions have been successfully applied to various membrane proteins and can be adapted specifically for ugpA expression and purification.

How can I validate the authenticity and purity of recombinant ugpA protein preparations?

Validating the authenticity and purity of recombinant ugpA preparations requires a multi-method approach:

Protein identity confirmation:

  • Western blotting with:

    • Anti-ugpA antibodies if available

    • Anti-tag antibodies (e.g., anti-His for His-tagged constructs)

    • Epitope-specific antibodies for specific domains

  • Mass spectrometry:

    • Peptide mass fingerprinting after tryptic digestion

    • Intact mass analysis for molecular weight confirmation

    • LC-MS/MS for sequence coverage and post-translational modification analysis

Purity assessment:

  • SDS-PAGE analysis:

    • Coomassie or silver staining for visual assessment

    • Densitometry for quantitative purity determination

    • 2D gel electrophoresis for detecting contaminant isoforms

  • Chromatographic methods:

    • Size exclusion chromatography for aggregation and oligomeric state analysis

    • Reverse-phase HPLC for purity assessment

    • Ion exchange chromatography for charge variant analysis

Functional validation:

  • Binding assays:

    • Isothermal titration calorimetry for substrate binding

    • Surface plasmon resonance for interaction kinetics

    • Fluorescence-based assays for conformational changes

  • Structural integrity:

    • Circular dichroism for secondary structure assessment

    • Thermal stability assays (DSF, nanoDSF)

    • Limited proteolysis to confirm proper folding

A comprehensive validation protocol should include multiple orthogonal methods, and acceptance criteria should be established for each test. For His-tagged recombinant ugpA preparations, as referenced in available sources, validation typically includes SDS-PAGE analysis, western blotting with anti-His antibodies, and mass spectrometry confirmation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.