Recombinant Shigella flexneri serotype 5b Spermidine export protein MdtI (mdtI)

What is the structural composition of Recombinant Shigella flexneri serotype 5b Spermidine export protein MdtI?

MdtI from Shigella flexneri serotype 5b is a full-length protein spanning 109 amino acids with the following sequence: MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA . The protein belongs to the Major Facilitator Superfamily (MFS) and functions as a spermidine export protein . When produced recombinantly, it is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and experimental handling .

For optimal experimental results when working with this protein, it's important to understand its functional domains and transmembrane structures. The protein contains several hydrophobic regions consistent with its role as a membrane transporter.

How should Recombinant MdtI protein be stored and reconstituted for experimental use?

Recombinant MdtI protein typically comes as a lyophilized powder and requires proper handling for optimal stability and functionality . The recommended storage protocol is:

For reconstitution:

• Centrifuge the vial briefly before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended 50%)

• Aliquot for long-term storage at -20°C/-80°C

Importantly, repeated freeze-thaw cycles should be avoided as they may compromise protein integrity . The protein is typically stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What experimental methods are used to verify the purity and identity of Recombinant MdtI protein?

Standard verification protocols for Recombinant MdtI include:

• SDS-PAGE analysis: The protein should demonstrate >90% purity

• Western blotting: Using anti-His antibodies to confirm the presence of the His-tag

• Mass spectrometry: To verify the exact molecular weight and amino acid composition

• Functional assays: To confirm spermidine export activity

For researchers seeking to validate their protein before experimental use, a combination of these methods is recommended to ensure both structural integrity and functional activity.

What role does MdtI play in antibiotic resistance mechanisms of Shigella flexneri?

As a member of the Major Facilitator Superfamily (MFS), MdtI functions primarily as a spermidine export protein but may also contribute to antimicrobial resistance through efflux mechanisms . Research suggests that MFS transporters like MdtI can export various compounds, potentially including antibiotics, contributing to the multidrug resistance phenotype observed in many Shigella isolates.

Experimental approaches to study MdtI's role in antibiotic resistance include:

• Gene knockout studies: Comparing susceptibility profiles of wild-type vs. mdtI-deleted strains

• Overexpression studies: Analyzing resistance patterns in strains overexpressing mdtI

• Transport assays: Measuring efflux of labeled antibiotics in membrane vesicles containing MdtI

Recent genomic analyses of clinical isolates have identified mdtI as part of strain-specific resistance determinants, suggesting its importance in the evolving antibiotic resistance landscape of Shigella flexneri .

How can Recombinant MdtI protein be integrated into vaccine development strategies against Shigella flexneri?

The development of effective vaccines against Shigella flexneri remains a significant challenge, with no licensed vaccines currently available . Recombinant MdtI represents a potential target for vaccine development based on several properties:

• Surface exposure: As a membrane protein, portions of MdtI are exposed to the external environment

• Conservation: MdtI sequences are relatively conserved across Shigella strains

• Functional importance: Targeting export proteins may impair bacterial fitness

Current methodological approaches similar to those used with other Shigella membrane proteins (like TolC) could be applied to MdtI :

• Reverse vaccinology approach: Evaluating MdtI's antigenic potential through computational prediction tools

• Recombinant protein expression: Optimizing expression systems for high-yield, correctly folded protein

• Immunogenicity testing: Evaluating antibody responses in animal models

• Challenge studies: Assessing protection against live Shigella challenge

Recent work with TolC as a recombinant protein vaccine against Shigella flexneri demonstrated effective protection in mouse models and could serve as a methodological template for MdtI-based vaccine studies .

What are the optimal experimental conditions for functional characterization of Recombinant MdtI?

Functional characterization of membrane transporters like MdtI requires specialized methodologies to preserve native conformation and activity:

• Membrane reconstitution: Incorporating purified MdtI into liposomes or nanodiscs

• Transport assays: Using fluorescently labeled spermidine to measure export activity

• Electrophysiological measurements: Patch-clamp techniques to measure transport kinetics

The functional activity should be assessed under various conditions to determine optimal pH, temperature, and ionic strength for MdtI activity, which typically aligns with the physiological conditions of the Shigella periplasmic environment.

How does MdtI compare structurally and functionally to other spermidine transporters in enteric pathogens?

Spermidine transporters are found across many enteric pathogens and play roles in polyamine homeostasis and potentially in virulence. Comparative analysis of MdtI with related transporters reveals:

• Sequence homology: MdtI shares significant sequence similarity with other MFS family transporters

• Structural conservation: Core transmembrane domains are typically conserved

• Functional divergence: Substrate specificity and transport efficiency can vary

When designing experiments to characterize MdtI, researchers should consider parallel studies with related transporters from E. coli and other enteric pathogens to identify shared mechanisms and unique features that might relate to Shigella's specific pathogenicity.

What genomic context surrounds the mdtI gene in different Shigella flexneri strains, and how might this influence its expression and function?

Genomic analysis of Shigella flexneri has revealed significant strain-to-strain variation, with the species being subdivided into seven phylogenetic groups (PGs), each containing multiple serotypes . The genomic context of mdtI can vary between these groups, potentially affecting its regulation and function.

Key considerations for researchers investigating mdtI genomic context include:

• Promoter regions: Variations may affect transcriptional regulation

• Operon structure: mdtI may be co-transcribed with other genes in some strains

• Mobile genetic elements: Presence of insertion sequences or transposons near mdtI

• Regulatory networks: Differences in global regulators controlling mdtI expression

Comparative genomic approaches, including whole genome sequencing of clinical isolates, have revealed that some strains contain unique gene combinations that may interact with mdtI function . These strain-specific genetic contexts should be considered when designing experiments and interpreting results.

What are the most effective protocols for expressing and purifying high yields of functional Recombinant MdtI?

Membrane proteins like MdtI present unique challenges for recombinant expression and purification. The following methodological approach is recommended based on established protocols:

• Expression system selection:

  • E. coli BL21(DE3) is commonly used for initial attempts

  • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Controlled expression using tunable promoters (e.g., T7lac)

• Expression optimization:

  • Lower temperatures (16-25°C) to slow protein production and facilitate folding

  • Induction at higher cell densities (OD600 of 0.6-0.8)

  • Addition of membrane-stabilizing compounds (e.g., glycerol)

• Extraction and purification:

  • Gentle cell lysis methods (enzymatic or pressure-based)

  • Membrane isolation through ultracentrifugation

  • Solubilization with mild detergents (DDM, LDAO)

  • IMAC purification using the His-tag

  • Size exclusion chromatography for final polishing

The purified protein should be maintained in stabilizing buffers containing appropriate detergents or reconstituted into lipid environments to preserve native conformation and activity.

What analytical techniques are most appropriate for studying MdtI interactions with potential transport substrates and inhibitors?

Understanding MdtI's interactions with substrates and potential inhibitors requires specialized analytical approaches:

• Binding assays:

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Surface plasmon resonance (SPR) for kinetic measurements

  • Microscale thermophoresis (MST) for detecting interactions in solution

• Structural studies:

  • X-ray crystallography (challenging for membrane proteins)

  • Cryo-electron microscopy for high-resolution structures

  • NMR spectroscopy for dynamic information

• Computational approaches:

  • Molecular docking to predict binding modes

  • Molecular dynamics simulations to study transport mechanisms

  • Homology modeling based on related transporters with known structures

These methodologies can help identify critical residues involved in substrate recognition and transport, which could serve as targets for rational drug design.

How can Recombinant MdtI be integrated into high-throughput screening systems for antimicrobial discovery?

MdtI's role in potential antimicrobial resistance makes it an interesting target for antimicrobial drug discovery. Researchers can develop high-throughput screening systems using:

• Whole-cell assays:

  • MdtI-overexpressing strains treated with compound libraries

  • Fluorescent substrate accumulation assays to measure inhibition of export

• In vitro transport assays:

  • Proteoliposomes containing purified MdtI

  • Plate-based fluorescence assays measuring substrate transport inhibition

• Binding screens:

  • Fragment-based screening using thermal shift assays

  • Competition assays with labeled substrate analogs

These approaches can identify compounds that specifically inhibit MdtI function, potentially overcoming resistance mechanisms and enhancing antibiotic efficacy against Shigella infections.

What experimental strategies can be used to investigate MdtI's role in Shigella flexneri pathogenesis and host-pathogen interactions?

Understanding MdtI's contribution to Shigella pathogenesis requires multiple experimental approaches:

• Infection models:

  • Cell culture invasion assays using mdtI knockout vs. wild-type strains

  • Animal models to assess virulence attenuation in mdtI mutants

  • Ex vivo tissue models to study bacterial behavior in complex environments

• Host response studies:

  • Transcriptomic analysis of host cells exposed to wild-type vs. mdtI-deficient strains

  • Immunological assays to measure differences in cytokine production

  • Microscopy techniques to visualize intracellular bacterial behavior

• Combined approaches:

  • Dual RNA-seq to simultaneously measure host and pathogen transcriptional responses

  • Systems biology methods to model the role of MdtI in infection dynamics

These investigations can reveal whether MdtI's primary role is in basic bacterial physiology or if it directly contributes to virulence mechanisms during infection.