Recombinant Shigella flexneri serotype 5b Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtJ; SFV_1615; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links

KEGG: sfv:SFV_1615

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella flexneri and why is serotype 5b significant?

Shigella flexneri, first discovered in 1897, is a Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacterium that causes shigellosis in humans and other primates. It is closely related to Escherichia coli and represents one of the leading bacterial causes of diarrhea worldwide, particularly affecting children in African and South Asian regions . Shigella flexneri accounts for approximately 60% of all Shigella isolates globally . Serotype 5b is one of at least 19 serotypes of S. flexneri, with most serotypes representing modifications of the same basic O-antigen through glucosylation and/or O-acetylation of sugar residues by phage-encoded serotype-converting genes . Understanding serotype 5b is important for epidemiological studies, vaccine development, and investigating antimicrobial resistance mechanisms.

How does the MdtJ protein function in spermidine export?

MdtJ functions as part of the MdtJI protein complex involved in spermidine excretion. Based on studies in E. coli (a close relative of Shigella), the MdtJ and MdtI proteins belong to the small multidrug resistance family of drug exporters . Both proteins are necessary for the efflux of spermidine from bacterial cells, protecting against toxicity caused by overaccumulation of this polyamine . The expression of MdtJI is upregulated by increased spermidine levels, as evidenced by increased mdtJI mRNA in the presence of spermidine . The complex actively catalyzes the excretion of spermidine from cells, with cells expressing functional MdtJI showing decreased intracellular spermidine content and enhanced spermidine excretion .

What structural elements of MdtJ are critical for its function?

Key amino acid residues in MdtJ that are essential for spermidine export activity include Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 . These residues likely form part of the substrate binding pocket or transport channel. In the related MdtI protein, residues Glu5, Glu19, Asp60, Trp68, and Trp81 are similarly important for function . The presence of multiple acidic residues (Glu) suggests a role in neutralizing the positively charged spermidine during transport. The conserved aromatic residues (Tyr, Trp) may be involved in substrate recognition through cation-π interactions with the polyamine substrate.

What expression systems are most effective for recombinant MdtJ production?

For recombinant MdtJ production, several expression systems can be considered:

Expression SystemAdvantagesConsiderations for MdtJ
E. coliHigh yield, rapid growth, well-established protocolsNative environment for homologous proteins, good for functional studies
YeastPost-translational modifications, less endotoxinBetter for complex membrane proteins requiring eukaryotic processing
BaculovirusHigh expression of membrane proteins, proper foldingUseful if E. coli produces inclusion bodies
Mammalian cellsMost sophisticated protein processingGenerally reserved for complex proteins requiring mammalian modifications

The choice should depend on research goals - E. coli systems may be preferable for structural studies due to higher yields, while yeast or baculovirus systems might be better if proper membrane insertion is challenging in E. coli .

How should researchers optimize the purification of recombinant MdtJ?

Purification of membrane proteins like MdtJ requires specialized approaches:

  • Membrane extraction: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to solubilize the protein while maintaining native conformation.

  • Affinity chromatography: Engineer the recombinant MdtJ with an affinity tag (His6, FLAG, etc.) for initial purification. Place the tag on the cytoplasmic domain to avoid interference with membrane insertion.

  • Size exclusion chromatography: Essential for separating properly folded MdtJ-detergent complexes from aggregates and confirming the oligomeric state (likely dimeric when complexed with MdtI).

  • Design of Experiments approach: Rather than optimizing purification by changing one factor at a time, implement a DoE strategy to systematically evaluate the effects of multiple variables (detergent concentration, pH, salt concentration, etc.) and their interactions . This approach provides statistical models that predict optimal conditions with fewer experiments.

  • Functional verification: Incorporate the purified protein into liposomes or nanodiscs to verify spermidine transport activity.

What quality control measures are essential for recombinant MdtJ research?

Rigorous quality control is critical for membrane protein research:

  • Purity assessment: SDS-PAGE analysis with Coomassie or silver staining (>95% purity recommended for functional studies).

  • Western blotting: Confirmation of identity using antibodies against MdtJ or the affinity tag.

  • Mass spectrometry: Verification of the complete amino acid sequence and identification of any post-translational modifications.

  • Circular dichroism: Assessment of secondary structure to confirm proper folding.

  • Thermal stability assays: Evaluation of protein stability under various buffer conditions.

  • Functional assays: In vitro reconstitution of spermidine transport activity using proteoliposomes or similar membrane mimetics.

  • Batch-to-batch consistency checks: Comparison of activity metrics between different purification batches to ensure reproducibility.

How can researchers effectively study MdtJ-MdtI complex formation?

The MdtJ-MdtI complex formation can be studied using several complementary approaches:

  • Co-immunoprecipitation: Express tagged versions of MdtJ and MdtI, then use antibodies against one tag to pull down the complex and detect the partner protein.

  • FRET analysis: Fuse fluorescent proteins to MdtJ and MdtI and measure fluorescence resonance energy transfer as an indicator of protein-protein interaction.

  • Bacterial two-hybrid systems: Utilize specialized two-hybrid systems adapted for membrane proteins to detect interactions in vivo.

  • Cross-linking coupled with mass spectrometry: Use chemical cross-linkers to stabilize the complex, followed by digestion and mass spectrometric analysis to identify interaction interfaces.

  • Blue native PAGE: Analyze the intact complex under non-denaturing conditions to determine the native oligomeric state.

  • Cryo-electron microscopy: For high-resolution structural determination of the complex architecture.

  • Genetic complementation assays: Test whether co-expression of MdtJ and MdtI can rescue spermidine sensitivity in knockout strains, as both proteins are necessary for function .

What approaches can detect spermidine transport activity of recombinant MdtJ?

To measure spermidine transport activity of the MdtJ-MdtI complex:

  • Whole-cell spermidine accumulation: Measure intracellular spermidine levels in cells expressing recombinant MdtJ-MdtI versus control cells using HPLC or LC-MS methods .

  • Radiolabeled spermidine efflux: Track the efflux of pre-loaded [14C]-spermidine from cells expressing MdtJ-MdtI.

  • Liposome-reconstituted transport assays: Reconstitute purified MdtJ-MdtI into liposomes and measure transport of fluorescently labeled spermidine or use a pH-sensitive dye to detect potential counter-ion movement.

  • Electrophysiology: Use patch-clamp techniques on giant liposomes or planar lipid bilayers containing reconstituted MdtJ-MdtI to measure transport-associated electrical currents.

  • Growth inhibition assays: Assess the ability of MdtJ-MdtI to confer resistance to toxic levels of spermidine (2 mM or higher) in a spermidine acetyltransferase-deficient bacterial strain .

How can Design of Experiments (DoE) improve recombinant MdtJ research?

Design of Experiments approaches offer significant advantages over traditional one-factor-at-a-time optimization:

  • Factorial designs: Allow simultaneous evaluation of multiple factors affecting MdtJ expression (temperature, inducer concentration, growth media composition, etc.) with fewer experiments than changing one factor at a time.

  • Response surface methodology: Helps identify optimal conditions for maximum protein yield and activity through mathematical modeling of experimental results .

  • Statistical validation: Provides quantitative assessment of which factors significantly impact MdtJ expression and function, and which interactions between factors are important.

  • Resource efficiency: Reduces cost and time investment by carefully selecting a minimal set of experiments that provides maximum information .

  • Software assistance: Various software packages are available to facilitate DoE approach selection, experimental design, and results analysis .

For example, instead of testing five induction temperatures and five IPTG concentrations separately (25 experiments), a DoE approach might use a central composite design requiring only 11 experiments while still identifying the optimal conditions.

How do mutations in key residues affect MdtJ structure and function?

Based on research in E. coli MdtJ, several key amino acid residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) are critical for function . To investigate structure-function relationships:

The pattern of conserved acidic and aromatic residues suggests a transport mechanism involving both electrostatic interactions and aromatic stacking with the polyamine substrate.

What is known about the regulation of mdtJ expression in Shigella flexneri?

While specific information about mdtJ regulation in S. flexneri is limited, insights can be extrapolated from E. coli studies:

  • Spermidine-responsive expression: In E. coli, mdtJI mRNA levels increase in response to elevated spermidine concentration, suggesting a feedback mechanism to prevent polyamine toxicity .

  • Potential transcriptional regulators: Polyamine-responsive transcription factors might bind to the mdtJI promoter region.

  • Integration with stress responses: Expression may be coordinated with other bacterial stress responses, as polyamine homeostasis is critical during various stress conditions.

  • Serotype-specific regulation: Given the serotype differences in S. flexneri, there may be serotype-specific regulation patterns related to the expression of various membrane transporters .

Research approaches should include:

  • Promoter mapping and analysis

  • Chromatin immunoprecipitation to identify regulators

  • Transcriptome analysis under various stress conditions

  • Reporter gene assays to measure promoter activity

How does the MdtJ-MdtI complex in Shigella flexneri compare with homologous complexes in other bacteria?

Comparing MdtJ-MdtI between different bacterial species can provide evolutionary and functional insights:

SpeciesHomology to S. flexneri MdtJNotable DifferencesFunctional Implications
E. coliVery high (>90% expected)Minor variations in non-critical regionsNearly identical function expected
Salmonella spp.Moderate to highPotential differences in regulatory regionsMay respond to different signals
Other Shigella speciesHigh within genusSerotype-specific variations possibleCould correlate with virulence differences
Distant Gram-negative bacteriaLower conservationSignificant structural differencesMay transport different polyamines

Research approaches should include:

  • Phylogenetic analysis of MdtJ sequences across bacterial species

  • Complementation studies to test functional conservation

  • Comparative structural modeling to identify conserved vs. variable regions

  • Expression profiling across different growth and stress conditions

How do serotype differences in Shigella flexneri affect membrane protein function?

Shigella flexneri serotypes differ primarily in their O-antigen structure through glucosylation, O-acetylation, or phosphoethanolamine modification patterns . These modifications can influence:

  • Membrane properties: Altered surface charge and hydrophobicity may affect the local environment of membrane proteins like MdtJ.

  • Host-pathogen interactions: Different serotypes show varying patterns of host cell invasion and immune evasion, which may correlate with expression patterns of membrane transporters.

  • Stress response variations: Serotype-specific differences in responding to host defense mechanisms may involve differential regulation of polyamine transport systems.

  • Horizontal gene transfer: Some serotype-converting elements are mobile genetic elements , which could co-transfer other genes affecting transporter expression or function.

Methodological approaches should include comparative genomics across serotypes, transcriptome analysis, and functional assays in different serotype backgrounds.

What techniques are most reliable for analyzing MdtJ topology in the membrane?

Membrane protein topology determination requires multiple complementary approaches:

  • Reporter fusion analysis: Create fusions of MdtJ fragments with reporters like alkaline phosphatase (periplasmic activity) or beta-galactosidase (cytoplasmic activity) to map orientation.

  • Cysteine accessibility methods: Introduce cysteine residues at various positions and test their accessibility to membrane-impermeable sulfhydryl reagents.

  • Protease protection assays: Determine which regions are protected from protease digestion in membrane vesicles.

  • Fluorescence quenching: Use environment-sensitive fluorophores to probe the membrane/aqueous environment of specific regions.

  • Cryo-electron microscopy: For high-resolution structural determination, particularly useful when combined with nanobody labeling of specific domains.

  • Computational prediction: Use multiple topology prediction algorithms (TMHMM, MEMSAT, etc.) to build a consensus model for experimental validation.

The validated topology model will inform structure-function studies by identifying which functional residues face the transport pathway versus the lipid bilayer.

How can researchers address contradictory data in MdtJ functional studies?

When facing contradictory results in membrane protein research:

  • Strain background effects: Test whether the same construct behaves differently in various E. coli or Shigella strains, as genetic background can influence membrane protein expression and function.

  • Expression level artifacts: Verify that apparent functional differences aren't simply due to varying expression levels using quantitative Western blots.

  • Membrane composition effects: Compare results in different membrane environments (native membranes vs. various liposome compositions).

  • Technical validation: Exchange materials and protocols between laboratories to identify subtle methodological differences.

  • Conformational states: Determine if conditions favor different conformational states of the transporter (e.g., inward-facing vs. outward-facing).

  • Post-translational modifications: Check for species or strain-specific modifications that might affect function.

  • Interaction partners: Identify if the presence/absence of accessory proteins explains functional differences.

What are the best approaches for studying the MdtJ-MdtI complex structure?

High-resolution structural information about the MdtJ-MdtI complex would significantly advance understanding of its function:

  • X-ray crystallography: Requires purification of stable, homogeneous, and crystallization-quality protein. Challenges include finding appropriate detergents and crystallization conditions for membrane protein complexes.

  • Cryo-electron microscopy: Increasingly powerful for membrane proteins, allowing visualization of the complex in a more native-like environment. May require larger complexes or antibody binding to increase particle size.

  • Solid-state NMR: Can provide structural information on membrane proteins in lipid environments, though typically at lower resolution than other methods.

  • Hydrogen-deuterium exchange mass spectrometry: Provides information about solvent-accessible regions and conformational changes upon substrate binding.

  • Cross-linking coupled with mass spectrometry: Identifies residues in close proximity, constraining structural models.

  • Molecular dynamics simulations: Can model substrate transport pathways and dynamics based on homology models or experimental structures.

  • Small-angle X-ray scattering: Provides low-resolution envelope information about the complex in solution.

How can researchers determine the substrate specificity of MdtJ beyond spermidine?

While MdtJ-MdtI is known to transport spermidine , its full substrate range requires investigation:

  • Competition assays: Test if other polyamines (putrescine, cadaverine, spermine) or structurally related compounds compete with spermidine transport.

  • Direct transport assays: Measure transport of radiolabeled or fluorescently labeled alternative substrates in whole cells or reconstituted systems.

  • Growth inhibition studies: Determine if MdtJ-MdtI expression confers resistance to toxic levels of potential substrate analogs.

  • Binding studies: Use isothermal titration calorimetry or microscale thermophoresis with purified protein to measure binding affinities for various compounds.

  • Molecular docking: Computationally predict binding of various polyamines to models of the transport channel.

  • Mutagenesis of binding site residues: Create mutations that alter the charge or size of the binding pocket and observe effects on substrate selectivity.

What is the relationship between MdtJ-mediated polyamine transport and Shigella virulence?

The connection between polyamine transport and virulence is an important research direction:

  • Infection models: Compare wild-type and mdtJ deletion mutants in cellular invasion assays and animal infection models.

  • Intracellular survival: Determine if MdtJ is important for survival within host cells, where polyamine concentrations differ from extracellular environments.

  • Host polyamine sequestration: Investigate if host cells attempt to restrict bacterial growth by limiting polyamine availability, making transporters like MdtJ important for virulence.

  • Stress resistance: Test if MdtJ contributes to resistance against host-derived antimicrobial compounds.

  • Gene expression during infection: Use RNA-seq to determine if mdtJ expression changes during different stages of infection.

  • Serotype-specific effects: Compare the importance of MdtJ across different Shigella flexneri serotypes, including the recently characterized serotype Yv strains .

  • Polyamine-dependent virulence factor regulation: Investigate if maintaining proper intracellular polyamine levels via MdtJ affects expression of virulence factors.

How might CRISPR-Cas9 technologies advance MdtJ research?

CRISPR-Cas9 technologies offer powerful new approaches for studying membrane transporters like MdtJ:

  • Precise genome editing: Create clean deletions, point mutations, or tagged versions of mdtJ in the native Shigella genome without antibiotic resistance markers.

  • CRISPRi for controlled expression: Use catalytically inactive Cas9 (dCas9) to repress mdtJ expression in a tunable manner without complete deletion.

  • CRISPRa for overexpression: Employ dCas9-based activators to increase native mdtJ expression for functional studies.

  • Base editing: Introduce specific amino acid changes without double-strand breaks to study structure-function relationships.

  • Pooled screens: Create libraries of mdtJ variants to identify residues critical for different functions through selection experiments.

  • In vivo tracking: Tag MdtJ with fluorescent proteins at the genomic level to track expression and localization during infection.

  • Multiplexed editing: Simultaneously modify mdtJ and related genes to study redundancy and interactions within the polyamine transport network.

What computational approaches are most valuable for predicting MdtJ function?

Computational methods complement experimental approaches in several ways:

  • Homology modeling: Build structural models based on related transporters with known structures, focusing on the small multidrug resistance family.

  • Molecular dynamics simulations: Model conformational changes during the transport cycle and interactions with spermidine.

  • Evolutionary coupling analysis: Identify co-evolving residues that may be functionally linked, providing insights into the transport mechanism.

  • Machine learning approaches: Use trained algorithms to predict substrate specificity based on primary sequence.

  • Systems biology modeling: Integrate MdtJ function into whole-cell models of polyamine metabolism and transport.

  • Network analysis: Place MdtJ in the context of other transporters and metabolic pathways through protein-protein interaction and gene co-expression networks.

  • Quantum mechanical calculations: For detailed modeling of interactions between key MdtJ residues and transported substrates.

How can synthetic biology approaches enhance MdtJ functional studies?

Synthetic biology offers innovative strategies for membrane protein research:

  • Designer membrane environments: Create synthetic lipid compositions or nanodiscs that optimize MdtJ-MdtI function and stability.

  • Cell-free expression systems: Develop specialized cell-free systems for rapid production and functional analysis of membrane protein variants.

  • Biosensors: Engineer cells with fluorescent reporters that respond to changes in intracellular polyamine levels mediated by MdtJ activity.

  • Minimal cells: Express MdtJ in minimal or synthetic cells to study function in simplified membranes without confounding transporters.

  • Protein engineering: Create chimeric transporters by combining domains from MdtJ homologs to explore structure-function relationships.

  • Reconstitution in synthetic vesicles: Develop automated systems for rapidly testing functional variants in artificial membrane systems.

  • In vitro evolution: Apply directed evolution approaches to engineer MdtJ variants with enhanced stability or altered substrate specificity.

These advanced approaches will help researchers overcome the traditional challenges of membrane protein research and accelerate understanding of polyamine transport mechanisms in bacterial pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.