Recombinant Shigella flexneri serotype 5b Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will then fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
dsbD; SFV_4292; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-565
Protein Length
Full Length of Mature Protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAASQPVSVSQQEQHTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDVWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP
Uniprot No.

Target Background

Function
DsbD plays a crucial role in facilitating the formation of correct disulfide bonds in certain periplasmic proteins, including the assembly of periplasmic c-type cytochromes. It acts by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps.
Database Links

KEGG: sfv:SFV_4292

Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of DsbD in Shigella flexneri serotype 5b?

DsbD in Shigella flexneri serotype 5b functions primarily as an electron transfer protein in the bacterial periplasm, maintaining the redox balance necessary for proper protein folding. The protein transfers electrons from cytoplasmic thioredoxin to various periplasmic dithiol oxidoreductases, enabling the isomerization and correct formation of disulfide bonds in secreted and membrane proteins.

This function is particularly critical for Shigella's virulence factors, many of which require proper disulfide bond formation to maintain their structure and function. DsbD's activity supports the pathogen's ability to cause dysentery through maintaining the structural integrity of proteins involved in host cell invasion and intracellular survival . The genome comparison between S. flexneri 5b and other serotypes suggests conservation of this essential protein across strains, highlighting its fundamental role in bacterial physiology .

How should researchers reconstitute and store recombinant S. flexneri DsbD protein for optimal stability?

For optimal stability and activity of recombinant S. flexneri DsbD protein:

Reconstitution Protocol:

  • Centrifuge the vial briefly to collect all material at the bottom before opening

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended optimal: 50%)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

Storage Conditions:

  • Store the lyophilized powder at -20°C or -80°C upon receipt

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein activity

The protein is stable in Tris/PBS-based buffer at pH 8.0 with 6% trehalose. When handling membrane proteins like DsbD, it's important to maintain appropriate buffer conditions that mimic the native environment of the protein to preserve its structure and function during experimental procedures.

What are the recommended methods for assessing DsbD activity in vitro?

Recommended in vitro DsbD activity assay protocol:

  • Insulin Reduction Assay:

    • Prepare reaction buffer: 100 mM sodium phosphate, pH 7.0, 1 mM EDTA

    • Mix 0.1-1 µg recombinant DsbD, 0.33 mM DTT, and 0.13 mM insulin

    • Monitor the increase in turbidity at 650 nm as insulin precipitates when its disulfide bonds are reduced

    • Calculate activity by measuring the lag time before precipitation begins

  • Thiol-Disulfide Exchange Assay:

    • Prepare pre-reduced substrate proteins with accessible thiols

    • Incubate with recombinant DsbD in oxidizing conditions

    • Quench reactions at timed intervals with acid

    • Analyze disulfide bond formation by non-reducing SDS-PAGE

    • Quantify using densitometry

  • Fluorescence-Based Redox Assays:

    • Label substrate proteins with fluorescent dyes sensitive to redox state

    • Monitor real-time changes in fluorescence as DsbD catalyzes thiol-disulfide exchange

    • Calculate kinetic parameters (Km, Vmax) for different substrates

For data analysis, plot reaction rates against substrate concentration to determine enzyme kinetics parameters, which can be compared across different experimental conditions to assess factors affecting DsbD activity.

How does S. flexneri serotype 5b DsbD differ from DsbD proteins in other Shigella serotypes?

Comparative analysis of DsbD proteins from different Shigella serotypes reveals both conservation and divergence:

CharacteristicS. flexneri 5b DsbDS. flexneri 2a DsbDOther Shigella DsbDSignificance
Sequence identityReference>99% identical95-98% identicalHigh evolutionary conservation
Key functional domainsConserved Cys motifsIdentical motifsConserved motifsFunctional conservation
Genomic contextStable chromosomal regionSimilar contextVariable contextReflects genomic rearrangements
Expression levelBaselineSimilarVariableMay affect virulence

What structural and functional comparisons exist between S. flexneri DsbD and E. coli DsbD?

S. flexneri DsbD shares significant homology with E. coli DsbD, with several important comparisons:

  • Structural Similarities:

    • Both proteins contain three domains: an N-terminal periplasmic domain (nDsbD), a central transmembrane domain (tDsbD), and a C-terminal periplasmic domain (cDsbD)

    • Conserved cysteine residues in each domain form the electron transfer pathway

    • Similar membrane topology with multiple transmembrane segments

  • Functional Comparisons:

    • Both proteins facilitate electron transfer from cytoplasmic thioredoxin to periplasmic oxidoreductases

    • Similar substrate specificity, though S. flexneri DsbD may have adapted to specific virulence-related substrates

    • Comparable kinetic parameters in thiol-disulfide exchange reactions

  • Evolutionary Context:

    • The high conservation reflects the essential nature of this redox system in Enterobacteriaceae

    • Differences may relate to adaptations for pathogenicity in Shigella compared to commensal E. coli

The similarity between these proteins can be leveraged in research, as findings from the well-studied E. coli DsbD often apply to S. flexneri DsbD, providing valuable insights for experimental design and interpretation of results.

How does DsbD contribute to S. flexneri virulence and host-pathogen interactions?

DsbD plays a critical but indirect role in S. flexneri virulence through its fundamental contribution to protein folding and stability of virulence factors:

  • Virulence Factor Maturation:

    • DsbD supports the proper folding of type III secretion system (T3SS) components through redox homeostasis

    • Enables correct disulfide bond formation in adhesins and invasins necessary for host cell invasion

    • Supports structural integrity of proteins encoded within pathogenicity islands like SHI-1 and SHI-2

  • Stress Response During Infection:

    • Helps bacteria withstand oxidative stress encountered within host macrophages

    • Supports adaptation to changing redox environments during transmission and infection

  • Intracellular Survival:

    • Contributes to maintaining functional proteins needed for intracellular replication

    • Supports bacterial persistence within host cells through proteome stability

The comparison between S. flexneri serotypes reveals that despite differences in their pathogenicity islands, the core machinery for protein maturation, including DsbD, remains highly conserved . This conservation highlights the essential nature of these systems for successful host infection across different Shigella strains.

What is the potential of S. flexneri DsbD as a therapeutic target for shigellosis treatment?

S. flexneri DsbD represents a promising therapeutic target for several reasons:

  • Target Essentiality:

    • DsbD function is critical for bacterial survival and virulence

    • Analysis of essential metabolic proteins in S. flexneri has identified redox proteins as potential drug targets

  • Therapeutic Strategy Potential:

    • Inhibition of DsbD could disrupt multiple virulence mechanisms simultaneously

    • Small molecule inhibitors could block electron transfer or substrate binding

    • Peptide inhibitors could interfere with domain interactions within DsbD

  • Advantages as a Drug Target:

    • Absence of human homologs (human non-homologous) reduces potential side effects

    • Surface-exposed periplasmic domains provide accessibility for inhibitors

    • Conservation across Shigella species suggests broad-spectrum potential

  • Challenges to Consider:

    • Membrane-embedded nature may complicate inhibitor design

    • Need for inhibitors to cross the outer membrane of gram-negative bacteria

    • Potential for resistance development through compensatory mechanisms

The increasing prevalence of extensively drug-resistant S. flexneri strains, as reported in California , underscores the urgent need for novel therapeutic approaches. DsbD inhibition represents a strategy targeting bacterial systems distinct from conventional antibiotics, potentially overcoming current resistance mechanisms.

What genetic approaches can be used to study DsbD function in S. flexneri?

Advanced genetic approaches to study DsbD function include:

  • Conditional Knockdown Systems:

    • Implement tetracycline-regulated or CRISPR interference (CRISPRi) systems for dsbD

    • Create tunable repression of dsbD expression to study partial loss of function

    • Monitor effects on growth, stress response, and virulence at different expression levels

  • Site-Directed Mutagenesis:

    • Create point mutations in catalytic cysteine residues (e.g., C103, C461) to disable specific electron transfer steps

    • Generate domain-swap chimeras with DsbD from other bacteria to identify species-specific functions

    • Introduce epitope tags at permissive sites for protein localization and interaction studies

  • Reporter Fusion Constructs:

    • Create dsbD-fluorescent protein fusions to monitor localization

    • Develop redox-sensitive GFP fusions to DsbD substrates to monitor activity in vivo

    • Construct promoter-reporter fusions to study dsbD regulation under different conditions

  • Integration with -Omics Approaches:

    • Combine genetic manipulation with transcriptomics to identify genes affected by DsbD dysfunction

    • Use proteomics to identify changes in the disulfide proteome when DsbD function is altered

    • Implement metabolomics to assess effects on cellular redox state and energy metabolism

These approaches should incorporate appropriate controls and complementation experiments to verify phenotypes are specifically due to DsbD manipulation rather than polar effects or secondary mutations.

How can structural biology techniques be applied to characterize S. flexneri DsbD protein domains?

Structural Biology Approaches for S. flexneri DsbD Characterization:

  • Domain-Based Expression and Purification:

    • Express individual domains (nDsbD, tDsbD, cDsbD) separately to overcome challenges with full-length membrane protein

    • Use specialized tags and purification protocols optimized for each domain type

    • Employ detergent screening to identify optimal conditions for membrane domain stability

  • X-ray Crystallography:

    • Crystallize soluble domains (nDsbD, cDsbD) using vapor diffusion techniques

    • Implement surface entropy reduction mutations to promote crystal formation

    • For transmembrane domain, consider lipidic cubic phase crystallization

    • Collect diffraction data at synchrotron radiation facilities for high-resolution structures

  • Cryo-Electron Microscopy:

    • Use single-particle cryo-EM for full-length protein in nanodiscs or amphipols

    • Implement focused refinement on individual domains within the full-length context

    • Apply 3D classification to capture different conformational states

  • NMR Spectroscopy:

    • Apply solution NMR to individual soluble domains for dynamic information

    • Use solid-state NMR for transmembrane domain structural analysis

    • Implement ^15N/^13C labeling for detailed residue-specific information

  • Integrative Structural Biology:

    • Combine SAXS (small-angle X-ray scattering) with computational modeling

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

    • Validate models with crosslinking mass spectrometry to identify domain interactions

A successful structural characterization would provide insights into the electron transfer mechanism, substrate recognition, and potential inhibitor binding sites that could guide therapeutic development against S. flexneri infections.

How can S. flexneri DsbD be utilized in recombinant vaccine development?

S. flexneri DsbD protein offers several strategic advantages for recombinant vaccine development:

  • As an Antigen Carrier:

    • DsbD can be engineered as a fusion partner for foreign antigens

    • Its membrane localization can help display antigens on the bacterial surface

    • The protein's natural stability can enhance antigen preservation during vaccine production and storage

  • In Outer Membrane Vesicle (OMV) Vaccines:

    • DsbD can be overexpressed to increase its incorporation into OMVs

    • OMVs containing DsbD along with other S. flexneri antigens provide a multi-antigen approach

    • This strategy aligns with recent approaches using S. flexneri OMVs for vaccine development against both Shigella and ETEC

  • For Multicomponent Vaccine Strategies:

    • Combine DsbD-based constructs with other S. flexneri antigens (OmpA, OmpC, IcsA, SepA, Ipa proteins)

    • Create chimeric proteins containing protective epitopes from multiple Shigella serotypes

    • Engineer DsbD to display heterologous antigens from other enteric pathogens

  • Implementation Protocol:

    • Clone modified dsbD constructs into attenuated S. flexneri vaccine strains

    • Confirm protein expression and localization by immunoblotting

    • Validate immunogenicity in animal models through measurement of:

      • Antigen-specific antibody titers (serum IgG, mucosal IgA)

      • T-cell responses (IFN-γ, IL-17 production)

      • Protection against challenge with virulent S. flexneri

Recent work developing a recombinant S. flexneri strain expressing ETEC heat-labile toxin B subunit demonstrates the feasibility of using Shigella as a platform for cross-protective vaccine development , a principle that could be extended to DsbD-based approaches.

What proteomics approaches can reveal about DsbD interaction partners in S. flexneri?

Advanced proteomics approaches can elucidate the DsbD interactome in S. flexneri:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express His-tagged DsbD in S. flexneri under native promoter

    • Cross-link protein complexes in vivo with membrane-permeable crosslinkers

    • Solubilize membranes with appropriate detergents

    • Perform Ni-NTA pulldown followed by LC-MS/MS analysis

    • Use label-free quantification to identify enriched proteins compared to controls

  • Proximity-Based Labeling:

    • Generate DsbD fusions with BioID or APEX2 proximity labeling enzymes

    • Express in S. flexneri and activate labeling in vivo

    • Purify biotinylated proteins and identify by MS

    • Map spatial interaction networks in the periplasm and membrane

  • Redox Proteomics:

    • Compare the disulfide proteome in wild-type vs. dsbD mutant strains

    • Use differential alkylation to trap proteins with altered disulfide status

    • Identify DsbD-dependent disulfide bond formation in substrate proteins

    • Quantify changes in redox state across the proteome

  • Data Analysis Framework:

    • Apply bioinformatics filtering to eliminate common contaminants

    • Validate key interactions through reciprocal pulldowns

    • Construct interaction networks with functional clustering

    • Integrate with transcriptomics data to build regulatory models

This comprehensive proteomics approach would identify both direct binding partners and downstream substrates affected by DsbD activity, providing a systems-level understanding of its role in S. flexneri physiology and pathogenesis. Similar approaches have been used to characterize outer membrane proteins in S. flexneri OMVs , demonstrating the feasibility of these methods.

How might DsbD contribute to antimicrobial resistance mechanisms in S. flexneri?

DsbD may play multifaceted roles in antimicrobial resistance (AMR) in S. flexneri through several mechanisms:

  • Beta-lactamase Maturation:

    • DsbD's redox function may support proper folding of beta-lactamases like CTX-M-27

    • This connection is particularly relevant given recent reports of extensively drug-resistant S. flexneri serotype 2a harboring bla CTX-M-27

    • Improper disulfide bond formation in beta-lactamases can reduce their activity and stability

  • Efflux Pump Assembly:

    • Many efflux pumps contain disulfide bonds in their periplasmic domains

    • DsbD's electron transfer capability supports correct folding of these multidrug resistance proteins

    • Inhibition of DsbD could potentially sensitize resistant strains to antibiotics

  • Stress Response Coordination:

    • Antibiotic exposure triggers bacterial stress responses

    • DsbD contributes to oxidative stress management during antibiotic challenge

    • This indirect effect may enhance bacterial survival during antibiotic treatment

  • Research Approach to Investigate These Connections:

    • Generate dsbD knockdown in extensively drug-resistant S. flexneri isolates

    • Measure changes in minimum inhibitory concentrations (MICs) for various antibiotics

    • Assess beta-lactamase activity and stability in wild-type vs. dsbD mutant backgrounds

    • Use proteomics to identify changes in the abundance and folding state of AMR-related proteins

Understanding these connections could inform combination therapies targeting both conventional antibiotic resistance mechanisms and the protein quality control systems that support them, potentially addressing the growing concern of extensively drug-resistant Shigella .

What computational approaches can predict DsbD substrate specificity in S. flexneri?

Advanced computational methods to predict DsbD substrate specificity include:

  • Machine Learning Algorithms:

    • Train neural networks on known bacterial redox protein substrates

    • Incorporate features such as:

      • Cysteine content and spacing

      • Secondary structure predictions

      • Surface accessibility of cysteines

      • Conservation of residues surrounding cysteines

    • Validate predictions with experimental verification of top candidates

  • Molecular Docking and Dynamics:

    • Generate homology models of S. flexneri DsbD domains based on E. coli structures

    • Perform virtual screening of the S. flexneri proteome for potential binding partners

    • Apply molecular dynamics simulations to assess stability of predicted interactions

    • Calculate binding free energies to rank potential substrates

  • Network Analysis:

    • Construct protein-protein interaction networks incorporating known DsbD interactions

    • Apply graph theory algorithms to predict additional members of the DsbD pathway

    • Integrate with gene co-expression data to identify functionally related proteins

  • Workflow Implementation:

    • Develop a pipeline combining multiple prediction methods

    • Prioritize proteins involved in virulence based on genomic and proteomic data

    • Create a scoring system integrating multiple lines of evidence

    • Experimentally validate top candidates using biochemical approaches

This computational framework could help identify novel virulence-related substrates of DsbD, potentially revealing new therapeutic targets. The approach aligns with methods used to identify potential drug targets in S. flexneri through subtractive genomic analysis , but focuses specifically on the DsbD redox pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.