Recombinant Shigella flexneri serotype 5b Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Function in Bacterial Cell Wall Synthesis

Undecaprenyl-diphosphatase plays a pivotal role in the recycling pathway of lipid carriers essential for bacterial cell wall component assembly. The enzyme catalyzes a critical step that enables the continuous synthesis of various cell envelope polysaccharides.

Role in Undecaprenyl Phosphate Recycling

In bacterial cell wall synthesis, undecaprenyl phosphate (Und-P) serves as a lipid carrier for sugar moieties during the assembly of various cell envelope components. After the transfer of the sugar moiety to the growing polysaccharide chain, undecaprenyl pyrophosphate (Und-PP) is released. UppP then dephosphorylates Und-PP to regenerate Und-P, allowing it to participate in another round of cell wall component synthesis .

This recycling pathway is essential because the de novo synthesis of undecaprenyl phosphate by undecaprenyl pyrophosphate synthase (UppS) is energetically costly for the bacterial cell. Research has demonstrated that increasing the cellular pool of Und-P through overexpression of uppS can restore growth defects in certain bacterial mutants affected in polysaccharide biosynthesis pathways, highlighting the importance of maintaining adequate levels of this lipid carrier .

Interdependence with Other Biosynthetic Pathways

One of the most significant findings regarding S. flexneri uppP function relates to the interdependence between various cell envelope biosynthetic pathways. In S. flexneri, multiple essential cell envelope components share dependency on undecaprenyl phosphate as a lipid carrier, including:

  1. O antigen (Oag): A component of lipopolysaccharide that contributes to bacterial virulence

  2. Enterobacterial Common Antigen (ECA): A surface polysaccharide found in Enterobacteriaceae family members

  3. Peptidoglycan (PG): The structural component providing rigidity to the bacterial cell wall

These pathways compete for the available pool of undecaprenyl phosphate, creating a situation where disruption in one pathway can affect others. Research has shown that mutations in genes involved in ECA biosynthesis, such as wzyE (encoding the ECA polymerase), can affect O antigen polymerization, likely due to redistribution of the undecaprenyl phosphate pool .

Table 2: Effects of Genetic Manipulations on Shigella flexneri Cell Envelope Biosynthesis

Genetic ManipulationEffect on UppP/Und-PImpact on Cell EnvelopeFunctional Outcome
wzyE mutationDisruption of ECA polymerizationDecrease in O antigen polymerizationAltered surface polysaccharide profile
uppS overexpression in wzyE mutantIncreased Und-P poolRestoration of O antigen banding intensitySignificant rescue of growth defects
wecA overexpression in wzyE mutantCompetition for Und-P resourcesPartial restoration of O antigen banding intensityLimited rescue of growth defects

These observations highlight the critical role of uppP in maintaining the balance between competing biosynthetic pathways through its function in recycling undecaprenyl carriers. The enzyme's activity directly influences the availability of Und-P, which in turn affects multiple aspects of bacterial cell envelope biosynthesis and integrity.

Production and Characterization of Recombinant UppP

The production of recombinant Shigella flexneri serotype 5b undecaprenyl-diphosphatase typically involves expression systems designed to yield purified protein suitable for research and potential therapeutic applications.

Expression Systems and Purification

Recombinant production of S. flexneri uppP generally follows standard protein expression protocols adapted for membrane proteins:

  1. Gene cloning: The uppP gene is amplified from S. flexneri genomic DNA using specific primers designed to target the conserved domains of the gene

  2. Vector construction: The amplified gene is cloned into suitable expression vectors, often containing affinity tags to facilitate purification

  3. Host transformation: The constructed vector is transformed into a bacterial host, commonly Escherichia coli strains optimized for protein production

  4. Protein expression: Expression is induced under controlled conditions to maximize yield while maintaining protein folding and activity

  5. Purification: The recombinant protein is extracted and purified using chromatographic techniques appropriate for membrane proteins

The recombinant protein may include fusion tags determined during the production process, which can aid in purification and detection. These tags might be removed post-purification depending on the intended application of the protein.

Functional Characterization

The functional characterization of recombinant uppP typically involves assessing its enzymatic activity through various biochemical assays. While specific data for S. flexneri uppP activity is limited in the available literature, general approaches for characterizing this class of enzymes include:

  1. Phosphatase activity assays measuring the release of inorganic phosphate from undecaprenyl pyrophosphate

  2. Liposome reconstitution experiments to assess membrane integration and function

  3. Inhibition studies using known inhibitors of undecaprenyl pyrophosphate phosphatases, such as bacitracin

Similar to approaches used for other membrane proteins like OmpA of S. flexneri, the pore-forming activity of uppP might be determined by reconstitution into proteoliposomes and monitoring the osmotic swelling of these vesicles through optical density measurements .

Significance in Bacterial Physiology and Pathogenesis

The importance of uppP extends beyond its enzymatic function, influencing broader aspects of bacterial physiology and potentially contributing to pathogenesis.

Role in Antibiotic Resistance

The alternative name of uppP, "bacitracin resistance protein," highlights its role in antibiotic resistance . Bacitracin is an antibiotic that binds to undecaprenyl pyrophosphate, preventing its dephosphorylation and thereby inhibiting cell wall synthesis. By rapidly converting Und-PP to Und-P, uppP reduces the availability of the bacitracin target, conferring resistance to this antibiotic.

This function positions uppP as a contributor to intrinsic antibiotic resistance in S. flexneri and suggests potential approaches for developing antimicrobial strategies that target this enzyme or overcome its protective effects.

Impact on Bacterial Growth and Stress Response

The availability of undecaprenyl phosphate significantly impacts bacterial growth and division. Research has demonstrated that manipulation of the undecaprenyl phosphate pool through genetic modifications affects bacterial growth parameters. For instance, complementation with uppS, which would theoretically increase the cellular pool of Und-P, has been shown to restore growth defects in wzyE mutants of S. flexneri .

Table 3: Growth Characteristics of S. flexneri under Different Genetic Conditions

Genetic BackgroundGrowth CharacteristicFinal OD600 after 10hInterpretation
Wild-typeNormal growthNot specifiedBaseline comparison
wzyE mutantReduced growth0.6Disruption in ECA biosynthesis affects growth
wzyE mutant + pUppSImproved growth0.7Increasing Und-P pool rescues growth defect
wzyE mutant + pWecAReduced growth0.5Further competition for Und-P exacerbates defect

These observations highlight the importance of maintaining adequate levels of recycled Und-P through uppP activity for normal bacterial growth and stress response.

Potential Applications and Future Research Directions

Recombinant Shigella flexneri serotype 5b undecaprenyl-diphosphatase offers several potential applications in research and therapeutic development.

UppP as an Antimicrobial Target

Given its essential role in cell wall biosynthesis, uppP represents a potential target for antimicrobial development. Strategies might include:

  1. Direct inhibition of uppP enzymatic activity to disrupt undecaprenyl phosphate recycling

  2. Combination therapies targeting both uppP and other enzymes involved in cell wall synthesis

  3. Development of compounds that sequester undecaprenyl carriers, mimicking the action of bacitracin but potentially overcoming resistance mechanisms

The conservation of uppP across bacterial species enhances its appeal as a broad-spectrum target, although strategies would need to address potential issues with selectivity and the development of resistance mechanisms.

Research Applications

Recombinant S. flexneri uppP serves multiple research purposes:

  1. Structural studies to understand the mechanism of undecaprenyl diphosphate dephosphorylation

  2. Screening platforms for identifying novel inhibitors

  3. Investigation of membrane protein function and topology

  4. Studies on lipid carrier recycling in bacterial cell envelope biogenesis

The availability of recombinant protein facilitates these research applications, potentially leading to broader insights into bacterial physiology and antimicrobial resistance.

Relationship to Immunogenic Proteins

While uppP itself may not be an ideal vaccine candidate due to its membrane-embedded nature, research on other S. flexneri proteins like OmpA has demonstrated the potential of outer membrane proteins as immunogens inducing protective immune responses . Understanding how uppP influences the composition and integrity of the cell envelope could contribute to the development of novel vaccination strategies targeting surface-exposed structures.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
uppP; bacA; SFV_3097; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
uppP
Target Protein Sequence
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: sfv:SFV_3097

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what role does it play in Shigella flexneri?

Undecaprenyl-diphosphatase (uppP), also known as bacA, functions as an enzyme (EC 3.6.1.27) that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate. In Shigella flexneri serotype 5b, this enzyme is also referred to as the Bacitracin resistance protein, highlighting its role in antibiotic resistance . The protein is encoded by the uppP gene (synonymous with bacA) and serves as a critical component in peptidoglycan biosynthesis.

The primary function of uppP involves recycling the lipid carrier undecaprenyl phosphate, which is essential for transporting peptidoglycan precursors across the cytoplasmic membrane during cell wall synthesis. This process is particularly crucial for maintaining cell wall integrity during bacterial growth, division, and adaptation to environmental stresses. Without functional uppP, bacteria would face compromised cell wall synthesis, potentially affecting their survival and virulence.

Cell wall biosynthesis is especially important for pathogenic bacteria like S. flexneri during host colonization and infection, as it relates to bacterial survival in hostile host environments. While not directly studied in the context of virulence, the pathway uppP participates in represents a fundamental aspect of bacterial physiology that indirectly supports pathogenesis.

What are the structural characteristics of S. flexneri serotype 5b uppP protein?

According to available protein information, S. flexneri serotype 5b uppP consists of 273 amino acids with the sequence beginning with "MSDMHSLLIAAILGVVEGLTEFLPVS..." and continuing through the full sequence as documented . Analysis of this sequence reveals a predominantly hydrophobic protein consistent with its role as a membrane-associated enzyme.

The protein displays multiple predicted transmembrane domains, which is expected for an enzyme that interacts with membrane-embedded substrates like undecaprenyl pyrophosphate. The amino acid composition suggests a structure that positions the active site at the membrane interface to access its substrate efficiently.

The uppP protein belongs to a family of phosphatases that share a conserved catalytic mechanism. Though specific structural data such as crystal structures are not presented in the available research, homology modeling based on related bacterial phosphatases would likely reveal a conserved catalytic core with species-specific variations in peripheral regions.

The protein's structure must accommodate both membrane association and enzymatic function, allowing it to recognize its substrate and catalyze the hydrolysis of a pyrophosphate bond while integrated within the bacterial membrane environment.

How is recombinant uppP typically expressed and purified for research applications?

Recombinant S. flexneri serotype 5b uppP can be produced as a research-grade protein through several established molecular biology techniques. Based on standard protocols and product information, the typical expression and purification process involves :

  • Gene cloning: The uppP (bacA) gene from S. flexneri serotype 5b is cloned into an appropriate expression vector, often with an affinity tag to facilitate purification.

  • Expression system selection: While various expression systems exist, bacterial membrane proteins like uppP are commonly expressed in E. coli strains optimized for membrane protein production.

  • Culture conditions: Expression typically occurs under controlled conditions with variables including temperature, media composition, and induction parameters optimized to balance protein yield and proper folding.

  • Membrane fraction isolation: Since uppP is a membrane protein, isolation involves cell disruption followed by membrane fraction separation via ultracentrifugation.

  • Solubilization: Detergents are used to extract the protein from the membrane environment while maintaining its native conformation.

  • Affinity chromatography: Purification often employs tag-based methods, with the tag type determined during the production process to optimize purification efficiency .

  • Additional purification steps: Size exclusion or ion exchange chromatography may be used to achieve higher purity.

For storage, the purified protein is typically maintained in a Tris-based buffer with 50% glycerol at -20°C, with extended storage recommended at -20°C or -80°C . To preserve activity, repeated freezing and thawing should be avoided, and working aliquots can be kept at 4°C for up to one week.

How does uppP contribute to Shigella flexneri virulence and pathogenesis?

While the direct relationship between uppP and S. flexneri virulence has not been extensively characterized in the available research, several indirect connections can be inferred based on our understanding of bacterial pathogenesis mechanisms.

Cell wall integrity, which uppP helps maintain through its role in peptidoglycan biosynthesis, is fundamental to bacterial survival during infection. Research has demonstrated that multiple signaling pathways affect S. flexneri pathogenesis, and disruption of these pathways can diminish expression of key virulence genes . For instance, the stringent response alarmone (p)ppGpp has been shown to be required for S. flexneri virulence, with its disruption reducing bacterial invasion and intercellular spread .

The connections between uppP and virulence might include:

  • Stress adaptation: During host colonization, S. flexneri encounters various stresses including nutrient limitation, pH changes, and antimicrobial compounds. Proper cell wall maintenance through uppP activity could be critical for stress resistance.

  • Maintaining cellular integrity during invasion: S. flexneri invades intestinal epithelial cells, a process that subjects the bacterium to mechanical and environmental stresses requiring robust cell wall structure.

  • Supporting intercellular spread: Once inside host cells, S. flexneri spreads to adjacent cells, a process that depends on the IcsA protein . Cell wall integrity maintained by uppP activity may support this process.

Experimental approaches to further investigate these connections could include creating conditional uppP mutants and assessing their virulence in cell culture models, particularly examining invasion efficiency and intercellular spread capabilities.

What methodological challenges exist in studying membrane-bound enzymes like uppP?

Investigating membrane proteins such as uppP presents several significant methodological challenges that researchers must address through specialized techniques:

  • Expression and purification difficulties:

    • Membrane proteins often express poorly in heterologous systems

    • Proper folding and membrane insertion requires specific conditions

    • Solubilization requires detergents that must maintain native structure

    • Purification yields are typically lower than for soluble proteins

  • Structural analysis limitations:

    • Crystallization for X-ray diffraction is challenging due to hydrophobic surfaces

    • Detergent micelles can interfere with crystal contacts

    • NMR studies are complicated by size constraints and membrane environment requirements

    • Cryo-EM may require specialized grid preparations for membrane proteins

  • Enzymatic assay complexities:

    • The hydrophobic substrate (undecaprenyl pyrophosphate) requires proper solubilization

    • Maintaining enzyme activity in detergent environments is challenging

    • Reproducing the native membrane environment for optimal activity

    • Distinguishing specific activity from background phosphatase activity

  • In vivo functional studies:

    • Creating clean knockouts may affect membrane integrity

    • Complementation studies require proper membrane targeting

    • Distinguishing direct from indirect effects on cellular physiology

To address these challenges, researchers typically employ multiple complementary approaches, including:

  • Nanodiscs or liposome reconstitution to provide native-like membrane environments

  • Fusion partners to enhance expression and solubility

  • Multiple detergent screening to identify optimal conditions

  • Combined structural methods (computational modeling with experimental validation)

These methodological considerations are essential when designing experiments to characterize uppP function, regulation, and potential as a therapeutic target.

How can recombinant uppP be utilized in antimicrobial drug discovery?

Recombinant S. flexneri serotype 5b uppP represents a valuable tool for antimicrobial drug discovery, particularly given the rising antibiotic resistance in Shigella species . Several approaches leverage recombinant uppP in drug development:

  • Target-based screening:

    • High-throughput enzymatic assays using purified recombinant uppP

    • Screening of chemical libraries for inhibitors of phosphatase activity

    • Structure-activity relationship studies to optimize lead compounds

    • Counterscreening against human phosphatases to ensure selectivity

  • Structural biology approaches:

    • Using purified recombinant protein for structural determination

    • Structure-based drug design targeting active site or allosteric sites

    • Fragment-based screening to identify chemical starting points

  • Cellular validation systems:

    • Testing compounds in bacterial strains with modified uppP expression

    • Complementation studies with recombinant uppP to confirm target specificity

    • Measuring effects on peptidoglycan synthesis and cell wall integrity

  • Resistance mechanism studies:

    • Investigating potential resistance mechanisms using recombinant protein

    • Engineering mutations observed in resistant strains

    • Biochemical characterization of variant proteins

The potential of this approach is supported by the understanding that cell wall biosynthesis remains a validated antibacterial target, with several existing antibiotics targeting various steps in this pathway. Bacitracin itself targets the undecaprenyl pyrophosphate recycling pathway, though not directly through uppP inhibition .

The availability of purified recombinant uppP allows for detailed biochemical characterization that can inform rational drug design strategies, potentially leading to novel therapeutics against multidrug-resistant Shigella infections.

What are the optimal conditions for enzymatic assays measuring uppP activity?

Developing robust enzymatic assays for uppP activity requires careful optimization of multiple parameters to ensure reliable and reproducible results. The following methodological considerations are essential:

  • Substrate preparation:

    • Undecaprenyl pyrophosphate is highly hydrophobic and requires appropriate solubilization

    • Options include detergent micelles (Triton X-100, DDM), mixed micelles with phospholipids, or incorporation into liposomes

    • Commercial substrates may be used, but concentration determination requires specific methods due to the absence of chromophores

  • Reaction buffer optimization:

    • pH optimization typically in the range of 7.0-8.0

    • Divalent cation requirements (Mg²⁺, Mn²⁺) at concentrations of 1-10 mM

    • Ionic strength adjustment to maintain enzyme stability

    • Detergent concentration above critical micelle concentration but below inhibitory levels

  • Detection methods:

    • Colorimetric detection of released inorganic phosphate (malachite green, molybdate blue)

    • HPLC separation of substrate and product

    • Mass spectrometry for direct product detection

    • Coupled enzyme assays linking phosphate release to spectrophotometric changes

  • Assay validation parameters:

    • Linear range determination with respect to time and enzyme concentration

    • Controls for non-enzymatic hydrolysis

    • Specificity controls with known phosphatase inhibitors

    • Reproducibility assessment across multiple enzyme preparations

An optimized protocol might include:

ParameterTypical ConditionsOptimization RangeNotes
Buffer50 mM Tris-HCl pH 7.5pH 6.5-8.5Test multiple buffer systems
Salt100 mM NaCl50-200 mMAdjust for optimal activity
Divalent cations5 mM MgCl₂1-10 mM; test Mg²⁺, Mn²⁺, Ca²⁺Essential for activity
Detergent0.1% Triton X-1000.01-0.5%Above CMC but below inhibitory
Temperature37°C25-42°CPhysiologically relevant
Substrate50 μM undecaprenyl-PP5-200 μMEnsure solubility maintained
Enzyme0.1-1 μg purified proteinTitrate for linearityUse freshly thawed aliquots

Kinetic parameters determined through such optimized assays provide valuable information about enzyme efficiency and potential inhibitor mechanisms.

How can protein-protein interactions involving uppP be effectively studied?

Understanding uppP's interactions with other proteins provides insights into its regulation and broader role in cellular physiology. Several complementary approaches are effective for studying these interactions:

  • Co-immunoprecipitation strategies:

    • Antibody-based pulldown of tagged recombinant uppP

    • Crosslinking prior to solubilization to capture transient interactions

    • Gentle detergent conditions to maintain interaction integrity

    • Mass spectrometry identification of co-precipitated proteins

  • Bacterial two-hybrid systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) adapted for membrane proteins

    • Split-ubiquitin systems for membrane protein interactions

    • Quantification through reporter gene expression

    • Controls for membrane localization and protein expression

  • Proximity-based approaches:

    • BioID or TurboID fusions to uppP expressed in S. flexneri

    • In vivo biotinylation of proximal proteins

    • Streptavidin pulldown and mass spectrometry identification

    • Differentiates direct and indirect interactors within native context

  • Biophysical interaction characterization:

    • Surface Plasmon Resonance with detergent-solubilized or nanodisc-reconstituted uppP

    • Microscale Thermophoresis for interaction affinity determination

    • Analytical ultracentrifugation to detect complex formation

    • Fluorescence-based techniques (FRET, BRET) for in vitro or in vivo studies

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking to stabilize interactions

    • Digestion and identification of crosslinked peptides

    • Provides structural information about interaction interfaces

    • Compatible with detergent-solubilized membrane proteins

These approaches can reveal interaction partners involved in peptidoglycan synthesis, membrane organization, or regulatory pathways. Similar methodologies have been successfully applied to study virulence-associated proteins in S. flexneri, as evidenced by research on pathogenesis factors .

A typical workflow might begin with proximity labeling to identify potential interactors, followed by validation through co-immunoprecipitation and characterization of direct interactions using purified components. Functional validation through genetic approaches would complete the investigation.

What expression systems are most effective for producing functional recombinant uppP protein?

Producing functional recombinant uppP presents challenges common to membrane proteins but can be achieved through careful selection and optimization of expression systems:

  • Bacterial expression systems:

    • E. coli BL21(DE3) derivatives specialized for membrane proteins:

      • C41(DE3) or C43(DE3) strains for reduced toxicity

      • Lemo21(DE3) for tunable expression control

    • Expression vectors with moderate promoter strength:

      • pET series with T7 promoter and lac operator

      • Arabinose-inducible systems for tight regulation

    • Fusion partners to enhance solubility and detection:

      • N-terminal or C-terminal His-tags for purification

      • MBP or SUMO fusions for solubility enhancement

      • GFP fusions to monitor folding and membrane insertion

  • Optimization parameters:

    • Induction conditions:

      • Lower temperatures (16-25°C) to slow production rate

      • Reduced inducer concentrations (0.1-0.5 mM IPTG)

      • Extended expression periods (overnight)

    • Media composition:

      • Rich media (2xYT, TB) for high cell density

      • Supplementation with glycerol (0.5-1%) as membrane stabilizer

      • Defined media for controlled expression and isotopic labeling

  • Alternative expression systems:

    • Cell-free expression systems:

      • Provides direct access to the protein without extraction

      • Allows addition of detergents or lipids during synthesis

      • Reduced issues with toxicity or inclusion body formation

    • Yeast systems (Pichia pastoris):

      • Eukaryotic processing with prokaryotic simplicity

      • Strong induction with methanol

      • Integration into genome for stable expression

  • Extraction and purification considerations:

    • Membrane isolation through differential centrifugation

    • Detergent selection critical for functional extraction:

      • DDM (n-Dodecyl β-D-maltoside) often effective

      • LMNG (Lauryl Maltose Neopentyl Glycol) for stability

    • Purification typically through affinity chromatography

    • Storage in 50% glycerol at -20°C as recommended for the recombinant protein

Expression yield and protein quality should be validated through activity assays and structural integrity assessment (circular dichroism, thermal shift assays). The optimal expression system may vary depending on the specific requirements of the downstream applications.

How might CRISPR-Cas9 technologies advance functional studies of uppP in Shigella pathogenesis?

CRISPR-Cas9 technology offers powerful approaches for investigating uppP function in S. flexneri, particularly in the context of pathogenesis. These advanced genetic tools enable:

  • Precise genetic manipulation:

    • Generation of clean knockout strains to study essentiality

    • Introduction of point mutations to identify critical residues

    • Creation of conditional expression systems through promoter replacement

    • Precise tagging at endogenous loci for localization studies

  • High-throughput functional genomics:

    • CRISPR interference (CRISPRi) for tunable gene repression

    • CRISPR activation (CRISPRa) for enhanced expression

    • Pooled CRISPR screens to identify genetic interactions

    • Systematic mutagenesis to create comprehensive variant libraries

  • Infection model applications:

    • Real-time tracking of uppP expression during infection

    • CRISPR-mediated regulation of expression timing

    • Investigation of uppP requirement at different infection stages

  • Methodological approach comparison:

CRISPR ApplicationAdvantageLimitationExample Application for uppP
Complete knockoutClean genetic backgroundLethal if essentialConfirm gene essentiality
Conditional knockoutStudies essential genesTechnical complexityStudy role during specific infection stages
CRISPRiTunable repressionIncomplete knockdownDose-dependent phenotype analysis
Base editingPrecise point mutationsLimited to certain changesStructure-function analysis of catalytic residues
Prime editingFlexible sequence changesLower efficiencyIntroduction of tagged versions at native locus

Research approaches similar to those used in studying virulence genes, such as the methodology applied to investigate the role of (p)ppGpp in S. flexneri pathogenesis , could be adapted for uppP analysis. For example, CRISPR-engineered strains with modified uppP expression could be tested for their ability to form plaques in epithelial cell monolayers, similar to the examination of relA spoT mutants .

These genomic technologies would significantly advance our understanding of how uppP contributes to S. flexneri's adaptation to the intracellular environment, potentially revealing new strategies for antimicrobial development.

What is the potential for uppP inhibitors as novel therapeutic agents against Shigella infections?

The emergence of antimicrobial resistance in Shigella species creates an urgent need for novel therapeutic targets . UppP represents a promising candidate for inhibitor development based on several factors:

  • Target validation considerations:

    • Essential role in peptidoglycan synthesis pathway

    • No human homolog, reducing off-target effects

    • Existing precedent of targeting this pathway (bacitracin)

    • Potential to disrupt bacterial cell wall integrity

  • Inhibitor discovery strategies:

    • Structure-based virtual screening using homology models

    • Fragment-based screening against purified recombinant protein

    • High-throughput enzymatic assays with phosphatase activity readout

    • Whole-cell phenotypic screens with target validation

    • Repurposing screens of approved drug libraries

  • Potential advantages of uppP inhibitors:

    • Novel mechanism of action to overcome existing resistance

    • Potential narrow-spectrum activity against specific pathogens

    • Opportunity for combination therapy with existing antibiotics

    • Possible anti-virulence effects beyond growth inhibition

  • Challenges and considerations:

    • Membrane-embedded target requiring specific physicochemical properties

    • Penetration of Gram-negative outer membrane

    • Potential for resistance development

    • Selectivity against commensal bacteria

  • Development pipeline prospects:

    • Lead identification through recombinant protein screening

    • Medicinal chemistry optimization of physicochemical properties

    • In vitro and cellular validation studies

    • Animal model efficacy testing

    • Resistance potential assessment

The availability of recombinant uppP protein facilitates initial screening efforts, while research on S. flexneri pathogenesis mechanisms provides context for understanding the therapeutic implications of targeting this enzyme. Successful development of uppP inhibitors could address the significant global health burden of Shigella infections, particularly in low- and middle-income countries where these infections are most prevalent .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.