Recombinant Shigella flexneri serotype 5b Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Basic Properties

Recombinant Shigella flexneri serotype 5b Universal stress protein B (uspB) is a full-length protein comprising 111 amino acid residues. It is identified in scientific databases with the UniProt ID Q0SZH0 and is also referred to by the gene name uspB or the locus tag SFV_3506 . This protein belongs to the universal stress protein family, a group of proteins widely distributed among bacteria, archaea, fungi, and plants that are typically expressed under various stress conditions to promote cellular survival.

Genetic Context

The uspB gene is encoded in the Shigella flexneri serotype 5b genome. Shigella flexneri is a gram-negative pathogenic bacterium that has evolved from harmless enterobacterial relatives and causes severe diarrheal disease upon ingestion . The uspB gene represents one of numerous genes that may contribute to the pathogen's ability to survive under stressful conditions during host infection.

Recombinant Expression Systems

The recombinant form of Shigella flexneri serotype 5b uspB protein is typically produced in Escherichia coli expression systems. This heterologous expression approach allows for efficient production of the protein for research and analytical purposes . The recombinant protein is often engineered with an N-terminal histidine tag (His-tag) to facilitate purification and detection while preserving the native protein structure and function .

Purification and Quality Control

After expression in E. coli, the recombinant uspB protein undergoes purification processes that typically involve affinity chromatography, leveraging the attached His-tag. The purified product achieves greater than 90% purity as determined by SDS-PAGE analysis . This level of purity ensures that the recombinant protein is suitable for a variety of research applications, including structural studies, functional assays, and immunological analyses.

General Functions of Universal Stress Proteins

Universal stress proteins (USPs) constitute a family of proteins that are typically upregulated in response to a variety of stressors, including nutrient deprivation, oxidative stress, and exposure to antimicrobial agents. While the search results don't provide specific details about uspB function, USPs generally help bacteria respond to adverse conditions by modulating cellular metabolism, gene expression, and protein function .

Potential Role in Shigella flexneri

Although the specific function of uspB in Shigella flexneri serotype 5b is not explicitly described in the provided information, its classification as a universal stress protein suggests a role in stress response mechanisms that may be crucial for bacterial survival during infection. Shigella flexneri employs sophisticated strategies to invade host cells, evade immune responses, and establish infection, processes that likely involve stress adaptation mechanisms .

Hypothetical Protein Annotation

Interestingly, many proteins in bacterial genomes, including some in Shigella flexneri, are initially classified as hypothetical proteins (HPs) – proteins predicted from genomic sequences but lacking experimental validation of their function. Research efforts involve using bioinformatics tools to predict and assign functions to these proteins. It's possible that uspB was initially identified as a hypothetical protein before being classified as a universal stress protein based on sequence homology and predicted function .

Overview of Shigella flexneri as a Pathogen

Shigella flexneri is a gram-negative bacterial pathogen responsible for bacillary dysentery or shigellosis, a severe form of diarrhea. The pathogenesis of S. flexneri is primarily mediated by a Type III Secretion System (T3SS) encoded on a large virulence plasmid, which enables the bacterium to invade intestinal epithelial cells, escape from phagosomes, and spread intercellularly .

Infection Process and Stress Conditions

During infection, S. flexneri faces numerous stressful conditions, including:

  1. Acid stress in the stomach

  2. Oxidative stress from host immune responses

  3. Nutrient limitation within host cells

  4. Competition with commensal microbiota

These stressors necessitate robust stress response systems, potentially involving uspB, for successful colonization and infection .

Potential Contribution to Virulence

While direct evidence linking uspB to virulence mechanisms is not provided in the search results, stress response proteins often contribute indirectly to pathogenicity by enhancing bacterial survival under the stressful conditions encountered during infection. The ability to withstand host-imposed stresses is critical for pathogen persistence and successful infection establishment .

Vaccine Development Considerations

Recent research has explored recombinant Shigella flexneri strains as potential vaccine candidates against diarrheal diseases. Although not directly related to uspB, these approaches highlight the potential utility of recombinant S. flexneri proteins in vaccine development. For instance, researchers have developed a recombinant S. flexneri strain expressing the heat-labile enterotoxin B (LTB) subunit of enterotoxigenic Escherichia coli (ETEC), aiming to provide cross-protection against both pathogens .

Potential as a Drug Target

The rising antibiotic resistance in Shigella species has prompted the search for novel drug targets. Stress response proteins, including potentially uspB, represent attractive candidates for antimicrobial development due to their importance in bacterial survival under stressful conditions. Bioinformatics approaches are being employed to identify and characterize potential targets among hypothetical proteins and stress response proteins in the S. flexneri genome .

Experimental Tools and Reagents

Recombinant uspB protein serves as a valuable tool for various research applications:

  1. Development of antibodies for detection and localization studies

  2. Structural characterization of the protein

  3. Functional assays to understand stress response mechanisms

  4. Screening of potential inhibitors for drug discovery

Commercial availability of purified recombinant uspB facilitates these research endeavors .

Diagnostics and Detection

Recombinant uspB may also have applications in diagnostic assays for Shigella detection, particularly when used in conjunction with specific antibodies. ELISA-based detection methods utilizing recombinant proteins can provide sensitive and specific detection of bacterial pathogens in clinical and environmental samples .

Gaps in Current Knowledge

Despite the availability of recombinant uspB for research purposes, several knowledge gaps remain:

  1. The precise molecular function of uspB in Shigella flexneri

  2. Structural details and functional domains within the protein

  3. Regulation of uspB expression during infection

  4. Potential interactions with host factors

Addressing these gaps will require further experimental investigation beyond bioinformatic predictions .

Emerging Research Trends

Recent trends in Shigella research include:

  1. Development of outer membrane vesicle (OMV)-based vaccines

  2. Genome-wide functional annotation of hypothetical proteins

  3. Investigation of stress response mechanisms in antibiotic resistance

  4. Exploration of novel antimicrobial targets

These approaches may yield further insights into the role of uspB in Shigella biology and pathogenesis .

Potential for Therapeutic Intervention

Understanding the function of stress response proteins like uspB could inform novel therapeutic strategies against Shigella infections. Particularly with the growing concern of multidrug-resistant (MDR) strains, targeting non-conventional bacterial components involved in stress adaptation might provide alternative approaches to combat these pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uspB; SFV_3506; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links

KEGG: sfv:SFV_3506

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.