Recombinant Shigella flexneri serotype 5b UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

SourceOrganismUPF/ProteinRelevance to Query
S. dysenteriaeUPF0059/yebNDirectly describes yebN but in S. dysenteriae, not S. flexneri 5b
S. flexneri 5bUPF0194/ybhGDescribes a different UPF membrane protein
S. flexneri 2aOMPs (fepA, ompC)Lists conserved outer membrane proteins (OMP) but excludes yebN

Key Issue: No direct evidence exists in the provided sources for yebN (UPF0059) in S. flexneri serotype 5b. The yebN designation appears linked to S. dysenteriae based on commercial product descriptions .

Role of Outer Membrane Proteins (OMPs) in Virulence

OMPs like OmpA, OmpC, and IpaD are critical for:

  • Adhesion: Anchoring to host cells (e.g., IpaD forms part of the type III secretion system tip) .

  • Invasion: Facilitating bacterial entry into epithelial cells .

  • Immune Evasion: Modulating host immune responses (e.g., YfiB regulates c-di-GMP levels, influencing biofilm formation and intracellular survival) .

Comparative Genomic Data

ProteinFunctionConservation Across ShigellaSource
OmpCPorinHigh (93–100% identity)
YfiBc-di-GMP regulationPartial (shared with Pseudomonas)
IpaDT3SS needleSerotype-specific

Note: yebN is not listed in comparative analyses of S. flexneri 2a or 5b genomes .

Research Gaps and Hypothetical Roles of yebN

Given the absence of direct studies on S. flexneri 5b yebN, its potential roles are inferred from analogous proteins:

Hypothetical Functions

  1. Membrane Integrity: As a UPF0059 protein, it may stabilize the outer membrane or interact with virulence factors.

  2. Antigenic Potential: Recombinant OMPs (e.g., OmpA, SepA) are explored as vaccine candidates .

  3. Toxin-Antitoxin Systems: Membrane proteins like Lon protease stabilize virulence plasmids .

Challenges in Characterization

  • Limited Genomic Data: S. flexneri 5b genomes (e.g., Sf8401) lack detailed annotations for yebN .

  • Recombinant Production: Commercially available yebN is derived from S. dysenteriae , raising questions about serotype-specificity.

Vaccine Development

Recombinant Shigella membrane proteins (e.g., LTB in engineered OMVs) show promise as subunit vaccines . yebN could theoretically be evaluated for:

  • Cross-Serotype Reactivity: If conserved across Shigella species.

  • Adjuvant Potential: Enhancing immune responses to co-administered antigens.

Therapeutic Targeting

  • Antibiotic Resistance: OMPs like TolC are linked to multidrug resistance ; yebN may offer similar vulnerabilities.

  • Biofilm Disruption: Proteins regulating c-di-GMP (e.g., YfiB) are targets for antimicrobial strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; yebN; SFV_1407; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGAPLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: sfv:SFV_1407

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella flexneri and how is serotype 5b classified?

Shigella flexneri is one of four species of Shigella bacteria that causes shigellosis, a type of food poisoning characterized by abdominal pain, fever, and watery or bloody diarrhea . S. flexneri is classified into at least 19 serotypes based on O-antigen structure modifications . Serotype 5b specifically contains modifications of the basic O-antigen repeating unit through both glucosylation and phosphoethanolamine (PEtN) modifications, with the latter being responsible for the MASF IV-1 determinant . The serotype-specific modifications are encoded by genes such as gtrV (for serotype 5) along with potential additional modifications that distinguish the 5b variant.

What is the UPF0059 membrane protein family and what is known about YebN?

The UPF0059 membrane protein family includes conserved integral membrane proteins with largely unknown functions found across multiple bacterial species. Similar to the UPF0059 membrane protein MS0192 in Mannheimia succiniciproducens, these proteins typically contain multiple transmembrane domains and are characterized by specific conserved sequence motifs . While detailed structural information for YebN from S. flexneri serotype 5b is limited, homologous UPF0059 proteins typically feature multiple membrane-spanning regions that suggest roles in membrane transport, signaling, or maintenance of membrane integrity.

What expression systems are recommended for recombinant production of membrane proteins like YebN?

For recombinant expression of S. flexneri YebN, several methodological approaches have proven effective:

  • Bacterial expression systems: E. coli BL21(DE3) or C43(DE3) strains with specialized vectors containing T7 or tac promoters are recommended for membrane protein expression.

  • Expression tags: N-terminal or C-terminal tags (His6, GST, or MBP) can facilitate purification, with placement chosen to minimize interference with protein folding.

  • Growth conditions: Expression at lower temperatures (16-25°C) with reduced inducer concentrations helps prevent inclusion body formation for membrane proteins.

The methodology should include careful monitoring of cell toxicity during induction, as overexpression of membrane proteins often negatively impacts host cell viability.

How can I optimize solubilization and purification of YebN from S. flexneri serotype 5b?

The successful solubilization and purification of YebN requires a methodical approach:

  • Membrane fraction isolation: Following cell disruption by sonication or French press, differential centrifugation at 10,000 × g (10 min) followed by ultracentrifugation at 100,000 × g (60 min) effectively isolates the membrane fraction.

  • Detergent screening: A systematic approach testing multiple detergents is recommended, with the following effectiveness hierarchy often observed:

    • Mild detergents: DDM (n-Dodecyl β-D-maltoside) and LMNG (Lauryl maltose neopentyl glycol)

    • Moderate detergents: OG (n-octyl-β-D-glucoside)

    • Stronger detergents: SDS (only for denatured applications)

  • Purification strategy: A two-step chromatography approach using IMAC (Immobilized Metal Affinity Chromatography) followed by size exclusion chromatography in the presence of detergent micelles generally yields the highest purity.

Maintaining protein stability throughout purification is critical and may require buffer optimization including specific lipids, stabilizing agents, or amphipathic polymers.

What analytical methods are most effective for characterizing YebN structure and function?

A comprehensive characterization of YebN requires multiple complementary approaches:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure composition

    • Cryo-electron microscopy for membrane protein structure determination

    • Molecular dynamics simulations to predict structure-function relationships

  • Functional characterization:

    • Proteoliposome reconstitution assays to evaluate transport functions

    • Site-directed mutagenesis of conserved residues to identify functional domains

    • Bacterial two-hybrid analysis to identify protein-protein interactions

  • Localization studies:

    • Immunofluorescence microscopy with specific antibodies

    • GFP-fusion proteins for visualization of cellular distribution

    • Membrane fractionation coupled with Western blotting

Each approach provides complementary data to build a comprehensive understanding of the protein's biological role.

How does the serotype-specific O-antigen modification system interact with membrane proteins like YebN?

The O-antigen modification system in S. flexneri involves multiple mechanisms with potential interactions with membrane proteins like YebN:

  • Glucosylation modifications: Serotype-converting phages encode glucosyltransferase gene clusters (gtrABC) that mediate specific sugar additions to the O-antigen . These modifications may alter membrane properties and potentially influence the function or stability of membrane proteins like YebN.

  • Phosphoethanolamine (PEtN) modifications: The plasmid-encoded opt gene mediates PEtN addition to specific rhamnose residues in the O-antigen structure . This modification creates the MASF IV-1 determinant and converts traditional serotypes to variant forms.

  • Potential YebN involvement: While direct evidence is limited, membrane proteins like YebN may participate in:

    • Facilitating substrate transport for O-antigen modifications

    • Maintaining membrane integrity during modification processes

    • Signal transduction related to O-antigen status

Experimental approaches to investigate these interactions include co-immunoprecipitation studies, bacterial two-hybrid screens, and phenotypic analysis of deletion mutants.

What is the relationship between YebN and antibiotic resistance in extensively drug-resistant (XDR) Shigella strains?

The emergence of extensively drug-resistant (XDR) Shigella strains poses a significant public health challenge . The potential role of membrane proteins like YebN in this context may involve:

  • Efflux pump systems: YebN may function directly or indirectly with efflux pump complexes that export antibiotics from bacterial cells.

  • Membrane permeability: Alterations in YebN expression or structure could influence membrane permeability to antibiotics.

  • Stress response mechanisms: YebN may participate in bacterial stress responses that contribute to antibiotic tolerance.

Methodological approaches to investigate these relationships include:

  • Comparative transcriptomics between sensitive and resistant strains

  • Generation of yebN knockout mutants and assessment of minimum inhibitory concentrations (MICs)

  • Protein-protein interaction studies to identify partners in resistance mechanisms

How can molecular dynamics simulations help predict structure-function relationships in YebN?

Molecular dynamics (MD) simulations provide valuable insights into membrane protein behavior when experimental structural data is limited:

  • Homology model development: Using known structures of UPF0059 family proteins as templates, homology models of YebN can be constructed and refined.

  • Membrane embedding simulations: Simulating YebN within a lipid bilayer that mimics the S. flexneri membrane composition reveals:

    • Stable transmembrane regions

    • Lipid-protein interactions

    • Conformational flexibility

  • Functional predictions: MD simulations can identify:

    • Potential substrate binding pockets

    • Conformational changes associated with transport mechanisms

    • Critical residues for function through virtual mutagenesis

These computational approaches complement experimental methods and can guide the design of targeted experiments to validate functional hypotheses.

What approaches can resolve contradictions in experimental data when analyzing YebN function?

Contradictory experimental results are common when investigating novel membrane proteins. The following methodological framework helps resolve such contradictions:

  • Systematic evaluation of variables: Create a comprehensive table of experimental conditions to identify sources of variability:

Variable CategorySpecific ParametersPotential Impact
Expression SystemHost strain, vector, promoterProtein folding, modification state
Purification MethodDetergents, buffer composition, pHStructural integrity, activity
Experimental AssaysTemperature, substrates, time pointsKinetic parameters, specificity
Data AnalysisStatistical methods, normalizationInterpretation bias, significance
  • Complementary methodologies: Employ multiple independent techniques to verify findings from different experimental perspectives.

  • Negative controls: Include proper controls to distinguish specific effects from experimental artifacts.

This structured approach allows researchers to systematically identify the source of data contradictions and develop refined hypotheses.

How can comparative analysis of YebN across Shigella serotypes enhance understanding of its function?

Comparative analysis provides valuable insights into evolutionary conservation and functional importance:

  • Sequence alignment analysis: Comparing YebN sequences across various Shigella serotypes can identify:

    • Highly conserved residues likely essential for core function

    • Variable regions that may confer serotype-specific adaptations

    • Potential post-translational modification sites

  • Expression pattern analysis: Investigating expression levels across different serotypes and growth conditions reveals:

    • Conditions that upregulate or downregulate yebN expression

    • Correlation with virulence gene expression

    • Growth phase-dependent regulation

  • Phenotypic comparisons: Systematic phenotypic analysis of yebN mutants across serotypes can identify:

    • Serotype-specific functional requirements

    • Contribution to virulence in different host environments

    • Interactions with serotype-specific features like O-antigen modifications

This comparative approach helps distinguish conserved functions from serotype-specific adaptations.

What novel approaches could elucidate the role of YebN in Shigella pathogenesis?

Several cutting-edge methodologies show promise for advancing our understanding of YebN's role:

  • CRISPR interference (CRISPRi): Allows for tunable repression of yebN expression without complete gene deletion, enabling dose-dependent phenotypic analysis.

  • Proximity-dependent biotin identification (BioID): Identifies proteins that transiently interact with YebN during infection, potentially uncovering unexpected functional connections.

  • Single-cell analysis: Examines heterogeneity in YebN expression and localization during infection using techniques such as:

    • Single-cell RNA sequencing (scRNA-seq)

    • High-resolution microscopy with specific antibodies

    • Reporter fusions with fluorescent proteins

  • Host-pathogen interaction models: Advanced infection models including:

    • Intestinal organoids for tissue-specific interactions

    • Live cell imaging during infection

    • In vivo imaging in animal models

These approaches move beyond traditional biochemical characterization to examine YebN function in physiologically relevant contexts.

How might structural modifications of YebN contribute to serotype conversion in S. flexneri?

The relationship between membrane proteins and serotype conversion represents an emerging area of research:

  • Genetic linkage analysis: Investigation of genetic linkage between yebN variations and serotype conversion elements reveals:

    • Co-inheritance patterns

    • Potential horizontal gene transfer events

    • Evolutionary relationships between serotypes

  • Interaction with serotype conversion machinery: YebN may interact with the products of serotype-converting genes through:

    • Direct protein-protein interactions with serotype-specific gene products

    • Membrane organization that facilitates O-antigen modification

    • Transport of substrates required for serotype-specific modifications

  • Impact of plasmid-encoded factors: The pSFxv_2-like plasmids carrying the opt gene may also influence YebN function through:

    • Co-regulation of expression

    • Modification of membrane properties

    • Altered protein-protein interactions

Understanding these relationships could provide new insights into serotype conversion mechanisms beyond the currently established glucosylation and phosphoethanolamine modification pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.