Recombinant Shigella flexneri serotype 5b UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

Introduction

Shigella flexneri is a Gram-negative bacterium that causes bacillary dysentery, a significant cause of diarrheal infections worldwide . With the rise of multidrug-resistant Shigella strains and the absence of a licensed vaccine, research into the genetic factors influencing Shigella's virulence is critical for developing new therapeutic drugs and vaccines . One such factor is the yfbV gene, which encodes a UPF0208 membrane protein, also known as YfiB .

General Information

The yfbV gene, part of the yfiBNR operon system, is found in Shigella and other Gram-negative bacteria like Klebsiella, E. coli, and Yersinia pestis . The YfiBNR system regulates cyclic di-GMP (c-di-GMP) levels, a crucial secondary messenger involved in various bacterial processes, including biofilm formation, motility, cytotoxicity, exopolysaccharide synthesis, adhesion, and invasion .

Shigella flexneri Serotypes

Shigella flexneri has multiple serotypes, with at least 23 reported . Serotypes are determined by variations in the O-antigen structure, a polysaccharide on the bacterial surface . These variations involve the addition of glucosyl, O-acetyl, or phosphoethanolamine (pEtN) to the tetrasaccharide backbone of the O-antigen .

Research Findings on YfbV/YfiB

  • YfiB as part of the YfiBNR system YfiB is part of a tripartite signaling system (YfiBNR) that modulates c-di-GMP levels based on periplasmic stress indicators .

  • Impact on c-di-GMP levels YfiB influences intracellular c-di-GMP levels, affecting various downstream virulence factors .

  • Role in biofilm formation and invasion Knocking out the yfiB gene disrupts the YfiBNR system, which negatively impacts biofilm formation, bacterial invasion, and host-surface attachment .

  • Structural and functional assessment Structural and functional analyses of the YfiB protein have identified critical amino acid residues essential for the signaling system's proper functioning .

  • Complementation of yfiB KO mutant Complementation of a yfiB knockout mutant was achieved by cloning the yfiB gene from the S. flexneri 1c SFL2608 strain into a pBAD_Myc_HisA vector, creating the SFL2642 (YfiBComp) strain .

Potential for Drug and Vaccine Development

The study of YfiB enhances the understanding of Shigella's in vivo persistence and survival, shedding light on c-di-GMP-led regulation of virulence . YfiB represents a potential target for designing new anti-infection drugs and vaccines against S. flexneri and other bacterial pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; SFV_2362; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGLLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: sfv:SFV_2362

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella flexneri and why is studying its membrane proteins important?

Shigella flexneri is a facultative anaerobic Gram-negative rod bacterium in the Enterobacteriaceae family that causes bacillary dysentery or shigellosis . S. flexneri is non-motile with no flagella, distinguishing it from other Enterobacteriaceae, and does not ferment lactose like E. coli or produce hydrogen sulfide like Salmonella . This pathogen is particularly significant as it represents the most common Shigella species causing infectious diarrhea in tropical and subtropical regions . Studying S. flexneri membrane proteins is critical because these proteins often play essential roles in virulence, antibiotic resistance, and environmental adaptation. Many membrane proteins participate in the invasive process through which Shigella enters epithelial cells, contribute to survival within host cells, and mediate resistance to host defense mechanisms. The Type III Secretion Apparatus (T3SA), which contains multiple membrane components, is encoded on the virulence plasmid pWR100 and is essential for S. flexneri pathogenesis . Understanding membrane proteins like YfbV may reveal new targets for therapeutic intervention or vaccine development against this significant pathogen.

What are the current methods for growing and manipulating S. flexneri for membrane protein studies?

For effective membrane protein studies with S. flexneri, researchers typically use streptomycin-resistant S. flexneri serotype 5a (M90T-Sm) as a parent strain for genetic manipulations . The bacterium is routinely cultured in Trypticase soy broth (TSB) with 0.01% Congo red, which helps visualize the virulent phenotype through red colony coloration . For antibiotic selection during genetic manipulation, tetracycline (5 μg/mL), ampicillin (100 μg/mL), kanamycin (25 μg/mL), and gentamicin (15 μg/mL) can be used depending on the resistance markers employed .

For genetic manipulation of membrane protein genes like yfbV, electroporation represents an effective transformation method. This typically involves:

  • Growing bacterial cultures to mid-log phase (OD600 0.4-0.6)

  • Washing cells multiple times with ice-cold water

  • Concentrating the bacteria by centrifugation

  • Mixing with purified DNA constructs in electroporation cuvettes

  • Applying an electrical pulse followed by recovery in TSB

  • Selection on appropriate antibiotic-containing media

For membrane protein isolation, protocols typically include cell disruption via sonication or French press, followed by differential centrifugation to isolate membrane fractions, with ultracentrifugation steps to separate inner and outer membranes based on their density differences.

How does the UPF0208 membrane protein family classification inform our approach to studying YfbV?

The UPF0208 (Uncharacterized Protein Family 0208) classification of YfbV provides important context for research approaches. This designation indicates that while the protein has been identified across multiple bacterial species, its precise function remains incompletely characterized. This classification guides research in several ways:

First, comparative genomic approaches are particularly valuable, as researchers can examine conservation patterns across different bacterial species to identify functionally important regions. Sequence alignment within the UPF0208 family may reveal highly conserved residues that are likely critical for protein function.

Second, the membrane localization indicated in the classification suggests that appropriate techniques for membrane protein research must be employed, including specialized solubilization and purification methods. Detergent screening is typically necessary to identify conditions that maintain protein stability and function during extraction from the membrane environment.

Third, researchers should consider potential structural similarities with other membrane proteins. Even without direct functional information, structural prediction tools can generate hypotheses about possible functions based on fold recognition and structural motifs.

Fourth, systems biology approaches are particularly valuable for UPF0208 family proteins, examining how gene expression changes under different conditions and identifying potential interaction partners that might provide functional clues.

What are the optimal methods for cloning and expressing the yfbV gene from S. flexneri serotype 5b?

For successful cloning and expression of the yfbV gene from S. flexneri serotype 5b, researchers should consider a systematic approach tailored to membrane protein production:

Gene amplification and cloning strategy:

  • Design primers that include appropriate restriction sites compatible with the chosen expression vector

  • Extract genomic DNA from S. flexneri serotype 5b using standard protocols

  • Amplify the yfbV gene using high-fidelity PCR with optimized conditions

  • Clone the PCR product into an intermediate vector for sequence verification

  • Subclone into an expression vector with an appropriate tag (N-terminal tags are often preferred for membrane proteins unless the N-terminus is critical for function)

Expression vector selection:
For membrane proteins like YfbV, vectors with the following features are recommended:

  • Tightly regulated promoters (T7 or arabinose-inducible systems)

  • Fusion tags that aid purification and detection (His6, FLAG, or Strep-II)

  • Signal sequences if targeting to specific membrane compartments is needed

  • Cleavage sites for tag removal if required for functional studies

Host strain selection:
Based on experimental protocols for S. flexneri, several expression systems can be considered:

  • E. coli C41(DE3) or C43(DE3) strains, which are engineered for membrane protein overexpression

  • Modified S. flexneri strains for homologous expression, such as derivatives of M90T-Sm

  • Cell-free expression systems that allow direct incorporation into liposomes or nanodiscs

Optimized expression conditions:

  • Culture bacteria in media supplemented with supplements that enhance membrane protein production (glycerol, specific metal ions)

  • Induce at lower temperatures (16-20°C) to slow down protein synthesis and improve folding

  • Use lower inducer concentrations for more controlled expression

  • Consider the addition of chemical chaperones like glycerol or specific lipids to the growth medium

Successful expression can be verified through Western blotting targeting the fusion tag or using antibodies specific to YfbV if available.

What are the most effective solubilization and purification strategies for recombinant YfbV protein?

Solubilizing and purifying membrane proteins like YfbV requires specialized approaches to maintain structural integrity and function:

Membrane fraction isolation:

  • Harvest bacterial cells during mid-log to late-log phase

  • Disrupt cells via sonication, French press, or enzymatic methods

  • Remove unbroken cells and debris by low-speed centrifugation (10,000×g)

  • Isolate membrane fractions by ultracentrifugation (typically 100,000×g for 1 hour)

  • Wash membrane pellets to remove peripheral proteins

Detergent screening:
A systematic detergent screen is critical for membrane protein solubilization. For YfbV, the following detergents should be evaluated:

DetergentWorking ConcentrationPropertiesSuitable Applications
DDM1-2% for extraction, 0.02-0.05% for purificationMild, maintains functionInitial solubilization
LDAO0.5-1%Forms small micellesCrystallography
OG0.8-1.2%Easily dialyzableNMR studies
Digitonin0.5-1%Very mild, preserves interactionsComplex stabilization
Triton X-1000.5-1%Effective solubilizerInitial screening

Purification strategy:

  • Affinity chromatography using the fusion tag (IMAC for His-tagged constructs)

  • Size exclusion chromatography to remove aggregates and assess oligomeric state

  • Ion exchange chromatography as a polishing step

  • Consider detergent exchange during purification if the initial solubilization detergent is not optimal for downstream applications

Protein stabilization:
The stability of purified YfbV can be enhanced by:

  • Addition of specific lipids that may be required for stability

  • Buffer optimization (pH, salt concentration, specific ions)

  • Addition of glycerol (10-20%) to prevent aggregation

  • Maintaining low temperature throughout purification

  • Considering reconstitution into nanodiscs or liposomes for long-term stability

Quality control:

  • SDS-PAGE and Western blotting to assess purity

  • Size exclusion chromatography to verify monodispersity

  • Circular dichroism to confirm secondary structure integrity

  • Thermal shift assays to optimize stabilizing conditions

How can researchers efficiently generate and characterize YfbV knockout mutants in S. flexneri?

Creating and characterizing YfbV knockout mutants requires careful genetic manipulation and comprehensive phenotypic analysis:

Knockout strategy using homologous recombination:

  • Design primers to amplify upstream and downstream regions flanking the yfbV gene

  • Clone these regions into a suicide vector flanking an antibiotic resistance cassette

  • Transform the construct into S. flexneri using electroporation as described in the literature

  • Select transformants on appropriate antibiotic media

  • Verify the knockout by PCR, sequencing, and Western blotting to confirm absence of the YfbV protein

Alternative CRISPR-Cas9 approach:

  • Design sgRNA targeting the yfbV gene

  • Clone the sgRNA into a CRISPR-Cas9 vector compatible with S. flexneri

  • Co-transform with a repair template containing homology arms and selection marker

  • Select and verify mutants as described above

Complementation for validation:

  • Clone the wild-type yfbV gene into an expression vector compatible with S. flexneri

  • Transform the complementation construct into the knockout strain

  • Verify expression of YfbV in the complemented strain

  • Compare phenotypes between wild-type, knockout, and complemented strains to confirm specificity

Comprehensive phenotypic characterization:

  • Growth curves under various conditions (different media, temperatures, pH values)

  • Stress resistance assays, particularly bile salt resistance tests based on findings that membrane modifications affect bile resistance in Shigella

  • Biofilm formation assessment, as membrane proteins can influence this process

  • Antibiotic susceptibility testing, especially since membrane proteins often contribute to resistance

  • Cell invasion assays using epithelial cell lines to assess virulence

  • Transcriptomic analysis to identify compensatory changes in gene expression

  • Proteomic analysis of membrane fractions to identify changes in membrane composition

Assessing bile salt resistance:
Based on research findings that S. flexneri adapts to bile salts through membrane modifications, testing the yfbV knockout strain for altered bile salt resistance would be particularly informative . This could involve:

  • Growth curve analysis in the presence of various concentrations of bile salts

  • Assessment of biofilm formation in response to bile salt exposure

  • Measurement of membrane permeability in the presence of bile salts

  • Gene expression analysis of known bile resistance factors in the yfbV mutant

How might YfbV protein interact with S. flexneri virulence mechanisms?

Understanding the potential relationship between YfbV and S. flexneri virulence requires consideration of several established virulence mechanisms and how membrane proteins might influence them:

S. flexneri pathogenesis depends on a repertoire of virulence factors, many encoded on the virulence plasmid pWR100, including components of the Type III Secretion Apparatus (T3SA) . As a membrane protein, YfbV might interact with these virulence systems in several ways:

1. Type III Secretion System interaction:
YfbV could potentially modulate the assembly or function of the T3SA machinery, which spans both bacterial membranes. Membrane proteins often serve as scaffolds or regulators for multiprotein complexes. Research approaches could include:

  • Co-immunoprecipitation studies with T3SA components

  • Localization studies to determine if YfbV colocalizes with T3SS proteins

  • Functional assays measuring secretion efficiency in wild-type versus yfbV mutants

2. Virulence gene regulation:
YfbV might participate in environmental sensing that triggers virulence gene expression. S. flexneri responds to environmental signals like bile salts by inducing virulence genes . Research approaches could include:

  • Transcriptomic analysis comparing virulence gene expression in wild-type versus yfbV mutant strains under various conditions

  • Reporter gene assays to measure virulence promoter activity

  • ChIP-seq analysis if YfbV interacts with DNA-binding regulators

3. Outer membrane vesicle (OMV) composition:
If YfbV influences OMV formation or composition, this could affect virulence factor delivery. Research has shown that S. flexneri OMVs can carry virulence factors and are being explored as vaccine platforms . Research approaches could include:

  • Comparative proteomic analysis of OMVs from wild-type versus yfbV mutants

  • Quantification of OMV production

  • Assessment of OMV-mediated virulence factor delivery

4. Interaction with established virulence factors:
YfbV might directly interact with known virulence factors. Multiple virulence genes have been identified in S. flexneri, including ipaH, virA, ipaBCD, ial, sen, and set1A/B . Research approaches could include:

  • Bacterial two-hybrid screening to identify protein-protein interactions

  • Co-immunoprecipitation followed by mass spectrometry

  • FRET or BiFC assays to visualize interactions in vivo

5. Host-pathogen interface:
As a membrane protein, YfbV might participate in interactions with host cell receptors or defense mechanisms. Research approaches could include:

  • Adhesion and invasion assays comparing wild-type and yfbV mutants

  • Host cell response analysis (cytokine production, signaling pathway activation)

  • Resistance to host antimicrobial peptides

How can structural analysis of YfbV contribute to understanding its function in S. flexneri?

Structural characterization of YfbV can provide critical insights into its function through multiple complementary approaches:

1. Computational structure prediction and analysis:

  • Generate homology models based on structurally characterized members of the UPF0208 family

  • Identify conserved structural motifs that might indicate function

  • Predict transmembrane topology and potential ligand-binding sites

  • Molecular dynamics simulations to explore conformational dynamics

2. Experimental structure determination options:

  • X-ray crystallography: Requires high-purity, stable, crystallizable protein preparations, often facilitated by creating fusion proteins with crystallization chaperones

  • Cryo-electron microscopy: Particularly suitable if YfbV forms complexes with other proteins

  • NMR spectroscopy: Feasible for determining structures of individual domains or if the full protein is relatively small

3. Structure-guided functional analysis:

  • Site-directed mutagenesis of predicted functional residues based on structural data

  • Creation of chimeric proteins to test domain-specific functions

  • Structure-based design of specific inhibitors to validate functional predictions

4. Comparative structural analysis:
The function of YfbV can be inferred by comparing its structure with proteins of known function. Structural similarities often reveal functional relationships even when sequence similarity is low.

5. Analysis of protein-ligand interactions:
If YfbV binds specific ligands (lipids, small molecules, or other proteins), structural studies can identify binding sites and binding modes:

  • Co-crystallization with potential ligands

  • NMR chemical shift perturbation experiments

  • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

6. Mapping evolutionary conservation onto structure:
Mapping sequence conservation from multiple YfbV homologs onto the three-dimensional structure can identify functionally important regions:

  • Highly conserved surface patches often indicate interaction sites

  • Conserved internal residues typically contribute to structural stability

  • Conserved pockets may represent active sites or ligand-binding sites

The structural information can guide the design of functional assays specifically targeted to test hypotheses about YfbV's role in S. flexneri physiology and pathogenesis.

What is the potential role of YfbV in antibiotic resistance mechanisms of S. flexneri?

Membrane proteins like YfbV can contribute to antibiotic resistance through various mechanisms, warranting systematic investigation:

1. Efflux pump association:
YfbV could function as part of or in association with efflux pump systems. The AcrAB efflux pump has been identified as important for bile salt resistance in S. flexneri, and similar mechanisms often contribute to antibiotic resistance . Research approaches should include:

  • Antibiotic accumulation assays in wild-type versus yfbV mutant strains

  • Co-immunoprecipitation studies with known efflux pump components

  • Expression analysis of efflux pump genes in yfbV mutants

2. Membrane permeability alteration:
YfbV might influence membrane composition or structure, affecting antibiotic penetration. Research has shown that lipopolysaccharide O-antigen synthesis is important for bile salt resistance in S. flexneri, suggesting membrane barrier function is critical . Research approaches should include:

  • Membrane permeability assays using fluorescent dyes

  • Lipid composition analysis of membranes from wild-type versus yfbV mutants

  • Sensitivity testing to membrane-disrupting agents

3. Stress response pathway involvement:
YfbV might participate in stress response pathways that confer resistance. The connection between bile salt resistance and drug resistance noted in previous research suggests shared mechanisms . Research approaches should include:

  • Transcriptomic analysis of stress response genes in yfbV mutants

  • Survival assays under various stress conditions

  • Epistasis analysis with known stress response regulators

4. Biofilm formation influence:
If YfbV affects biofilm formation capabilities, this could impact antibiotic resistance, as cells in biofilms are generally more resistant to antimicrobials. S. flexneri has been shown to form biofilms in response to bile salts . Research approaches should include:

  • Quantitative biofilm formation assays

  • Antibiotic susceptibility testing of biofilm-grown cells

  • Microscopic examination of biofilm architecture

5. Experimental assessment of antibiotic resistance:
To comprehensively evaluate YfbV's role in resistance, researchers should perform:

  • Determination of minimum inhibitory concentrations (MICs) for multiple antibiotic classes

  • Time-kill kinetics to assess the rate of bacterial killing

  • Selection of resistant mutants under antibiotic pressure

  • Combination antibiotic testing to identify synergistic effects

For example, the following table structure could be used to systematically evaluate resistance profiles:

Antibiotic ClassRepresentative DrugsWild-type MIC (μg/ml)ΔyfbV MIC (μg/ml)Complemented Strain MIC (μg/ml)
β-lactamsAmpicillin, Ceftriaxone
FluoroquinolonesCiprofloxacin, Levofloxacin
AminoglycosidesGentamicin, Kanamycin
TetracyclinesTetracycline, Doxycycline
MacrolidesAzithromycin, Erythromycin

What are the most effective methods for analyzing protein-protein interactions involving YfbV?

Investigating protein-protein interactions involving membrane proteins like YfbV requires specialized approaches:

1. Co-immunoprecipitation with membrane-specific modifications:

  • Solubilize membranes with mild detergents that preserve protein-protein interactions (digitonin, DDM, or CHAPS)

  • Use antibodies against YfbV or epitope tags for immunoprecipitation

  • Identify interacting partners using mass spectrometry

  • Validate interactions with reverse co-IP experiments

2. Crosslinking approaches:

  • In vivo crosslinking with membrane-permeable reagents (formaldehyde, DSP)

  • Site-specific crosslinking using photo-activatable amino acid analogs incorporated into YfbV

  • Analysis of crosslinked products by mass spectrometry to identify interaction sites

3. Bacterial two-hybrid systems:

  • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system specifically designed for membrane protein interactions

  • Split-ubiquitin system as an alternative approach

  • Screening of genomic libraries to identify novel interacting partners

4. Proximity-based labeling:

  • BioID or APEX2 fusions to YfbV to biotinylate nearby proteins in vivo

  • Purification of biotinylated proteins followed by mass spectrometry

  • Allows detection of transient or weak interactions in native membrane environments

5. Fluorescence-based methods:

  • FRET between YfbV-fluorescent protein fusions and potential partners

  • BiFC (Bimolecular Fluorescence Complementation) to visualize interactions in living cells

  • FLIM (Fluorescence Lifetime Imaging Microscopy) for quantitative interaction analysis

6. Surface Plasmon Resonance (SPR):

  • Immobilize purified YfbV on sensor chips with appropriate membrane mimetics

  • Measure binding kinetics with purified potential interaction partners

  • Determine binding affinities and kinetic parameters

7. Native gel electrophoresis:

  • Blue native PAGE to preserve native protein complexes

  • Clear native PAGE for more sensitive detection of interactions

  • Subsequent identification of complex components by mass spectrometry

Data interpretation should focus on:

  • Distinguishing specific interactions from non-specific membrane protein associations

  • Validating interactions through multiple orthogonal methods

  • Correlating interaction data with functional assays

  • Mapping interaction domains through deletion and point mutant analysis

How should researchers analyze and interpret transcriptomic data from YfbV mutant studies?

Transcriptomic analysis of yfbV mutants compared to wild-type S. flexneri can provide valuable insights into the protein's functional role. The following methodological approach is recommended:

1. Experimental design considerations:

  • Include multiple biological replicates (minimum 3-4) for statistical validity

  • Consider multiple growth conditions, especially those relevant to infection (varying pH, bile salt exposure, oxygen limitation)

  • Include both exponential and stationary phase samples

  • Include the complemented strain to confirm specificity of observed changes

2. RNA isolation and quality control:

  • Use specialized methods for bacterial RNA isolation that maximize integrity

  • Verify RNA quality using bioanalyzer (RIN > 8.0 recommended)

  • Remove rRNA either during isolation or prior to library preparation

  • Quantify RNA accurately before proceeding to library preparation

3. Sequencing considerations:

  • Aim for >10 million reads per sample for adequate coverage

  • Consider strand-specific libraries to distinguish antisense transcription

  • Include appropriate spike-in controls for normalization

4. Data analysis pipeline:

  • Quality filtering of raw reads (trimming adapters, removing low-quality bases)

  • Alignment to S. flexneri reference genome

  • Quantification of transcript abundance

  • Differential expression analysis using appropriate statistical methods (DESeq2, edgeR)

  • Pathway and functional enrichment analysis

5. Validation approaches:

  • qRT-PCR validation of key differentially expressed genes

  • Protein-level validation for selected targets

  • Functional assays to confirm biological relevance of expression changes

6. Interpretation frameworks:

  • Focus on consistently altered pathways rather than individual genes

  • Analyze regulatory networks to identify potential master regulators

  • Compare with known stress response signatures

  • Integrate with other omics data when available

7. Specific analytical considerations for YfbV:
Based on the knowledge that membrane proteins in S. flexneri influence stress responses and virulence , particular attention should be paid to:

  • Virulence gene expression changes

  • Membrane stress response pathways

  • Genes involved in membrane modification or repair

  • Transport systems and efflux pumps

  • Metabolic adaptations that might compensate for YfbV loss

An example analytical table for organizing key differentially expressed genes might include:

Functional CategoryGeneLog2 Fold Changep-valueKnown FunctionPotential Relationship to YfbV
VirulencevirAEffector protein
Membrane integrity
Stress response
Transport
Metabolism

What proteomic approaches are most informative for analyzing the impact of YfbV on the S. flexneri membrane proteome?

Membrane proteomics presents unique challenges that require specialized approaches for comprehensive analysis of how YfbV affects the S. flexneri membrane proteome:

1. Sample preparation strategies:

  • Differential centrifugation to separate inner and outer membranes

  • Selective extraction of peripheral versus integral membrane proteins

  • Enrichment of hydrophobic peptides after digestion

  • Use of multiple complementary detergents for solubilization

2. Membrane protein enrichment:

  • Carbonate extraction to remove peripheral membrane proteins

  • Density gradient centrifugation for membrane fractionation

  • Biotinylation of surface-exposed proteins followed by affinity purification

  • Phase partitioning with Triton X-114 to separate hydrophobic proteins

3. Digestion strategies:

  • In-solution digestion with MS-compatible detergents (RapiGest, ProteaseMAX)

  • Filter-aided sample preparation (FASP) for detergent removal

  • Chymotrypsin or other alternative proteases for improving membrane protein coverage

  • Limited proteolysis to probe membrane protein topology

4. Mass spectrometry approaches:

  • Data-dependent acquisition for discovery proteomics

  • Multiple reaction monitoring for targeted quantification of specific proteins

  • Data-independent acquisition for comprehensive analysis

  • Crosslinking mass spectrometry to analyze protein-protein interactions

5. Quantification methods:

  • Label-free quantification for comparing wild-type and yfbV mutant proteomes

  • SILAC labeling for precise relative quantification

  • TMT or iTRAQ labeling for multiplexed comparison of multiple conditions

  • Absolute quantification using QconCAT or AQUA peptides for key proteins

6. Post-translational modification analysis:

  • Phosphoproteomics to identify signaling changes

  • Glycoproteomics for cell surface modifications

  • Lipid modifications relevant to membrane anchoring

  • Ubiquitination and SUMOylation affecting protein turnover

7. Data analysis considerations:

  • Use of specialized membrane protein databases

  • Topology prediction integration with proteomic data

  • Network analysis to identify protein complexes affected by YfbV deletion

  • Integration with transcriptomic data to identify post-transcriptional regulation

When interpreting proteomic data from YfbV studies, researchers should pay particular attention to:

  • Changes in virulence-associated proteins, especially those related to the Type III Secretion System

  • Alterations in membrane transporter abundance or modifications

  • Shifts in membrane lipid-associated proteins

  • Stress response proteins, particularly those involved in envelope stress responses

  • Changes in outer membrane vesicle composition, which has been implicated in S. flexneri virulence and studied as a vaccine platform

How might insights on YfbV contribute to vaccine development against Shigella flexneri?

Understanding YfbV structure and function could potentially contribute to vaccine development against Shigella flexneri through several mechanisms:

1. YfbV as a potential vaccine antigen:
If YfbV contains surface-exposed domains, these could serve as vaccine antigens. Membrane proteins often harbor conserved epitopes that can elicit protective immunity. Researchers should:

  • Analyze the topology of YfbV to identify surface-exposed regions

  • Assess conservation of YfbV across S. flexneri serotypes and other Shigella species

  • Evaluate immunogenicity of recombinant YfbV or peptide fragments

  • Test protective efficacy in animal models

2. YfbV-deficient strains as live attenuated vaccines:
If YfbV contributes to virulence but is not essential for growth, yfbV deletion mutants could potentially serve as live attenuated vaccine candidates. This approach would require:

  • Comprehensive virulence assessment of yfbV mutants in appropriate models

  • Evaluation of protective immunity elicited by attenuated strains

  • Safety assessment including reversion potential

  • Optimization of vaccine delivery and dosing

3. Incorporation into Outer Membrane Vesicle (OMV) vaccines:
Recent research has demonstrated the potential of S. flexneri OMVs as vaccine platforms . If YfbV influences OMV composition or can be engineered into OMVs, this could enhance vaccine development:

  • Characterize OMVs produced by wild-type versus yfbV mutant strains

  • Assess the incorporation efficiency of YfbV into OMVs

  • Evaluate immunogenicity of YfbV-containing OMVs

  • Consider engineering chimeric YfbV proteins carrying epitopes from other antigens

4. Cross-protective vaccine strategy:
Similar to the approach described for incorporating ETEC heat-labile enterotoxin B into Shigella , understanding YfbV could enable novel cross-protective strategies:

  • Assess conservation of YfbV across enteric pathogens

  • Engineer YfbV to display protective epitopes from multiple pathogens

  • Evaluate cross-protection in appropriate animal models

5. Adjuvant potential:
If YfbV has immunomodulatory properties, it might serve as an adjuvant for other Shigella antigens:

  • Assess cytokine profiles induced by purified YfbV

  • Evaluate enhancement of immune responses when co-administered with other antigens

  • Determine optimal formulation for adjuvant activity

Current Shigella vaccine development faces challenges including the lack of licensed vaccines and rising antibiotic resistance . Novel approaches based on membrane protein biology could address these challenges by providing new antigen candidates or delivery platforms.

What are the potential therapeutic applications of targeting YfbV in Shigella infections?

Beyond vaccine development, understanding YfbV could lead to novel therapeutic approaches for Shigella infections:

1. Direct inhibition strategies:
If YfbV plays an essential role in S. flexneri physiology or virulence, developing specific inhibitors could provide new therapeutic options:

  • Structure-based drug design targeting functional domains of YfbV

  • High-throughput screening for small molecule inhibitors

  • Peptide-based inhibitors mimicking interaction interfaces

  • Antibody-based therapeutics if YfbV has accessible extracellular domains

2. Antibiotic resistance modulation:
If YfbV contributes to antibiotic resistance mechanisms, as suggested by its potential membrane role and the known importance of membrane proteins in bile salt resistance , inhibiting YfbV could enhance antibiotic efficacy:

  • Combination therapy approaches with YfbV inhibitors and conventional antibiotics

  • Resensitization of resistant strains by targeting YfbV-mediated mechanisms

  • Prevention of resistance development through dual-targeting approaches

3. Anti-virulence approaches:
If YfbV contributes to virulence without being essential for survival, anti-virulence therapeutic strategies could be developed:

  • Inhibition of YfbV to attenuate virulence without selecting for resistance

  • Targeting YfbV-dependent virulence mechanisms

  • Interfering with YfbV-mediated host-pathogen interactions

4. Biofilm disruption:
If YfbV influences biofilm formation, as suggested by research showing S. flexneri forms biofilms in response to bile salts , targeting this protein could help disrupt biofilms:

  • Development of biofilm dispersal agents targeting YfbV

  • Combination approaches with conventional antibiotics

  • Prevention of biofilm formation in medical devices or surfaces

5. Host-directed therapy:
Understanding YfbV's interaction with host factors could enable host-directed therapeutic approaches:

  • Modulation of host pathways that interact with YfbV

  • Enhancement of specific immune responses targeting YfbV-expressing bacteria

  • Prevention of S. flexneri-induced damage to host tissues

Current treatment recommendations for shigellosis include fluoroquinolones, azithromycin, or ceftriaxone , but rising antibiotic resistance necessitates new approaches. Membrane protein-directed therapies could provide alternatives that circumvent existing resistance mechanisms.

What future research directions would most advance our understanding of YfbV and related membrane proteins in enteric pathogens?

To comprehensively understand YfbV and related membrane proteins in enteric pathogens, several key research directions should be prioritized:

1. Comprehensive functional characterization:

  • Creation of a complete mutant library covering all domains of YfbV

  • Phenotypic profiling under diverse environmental conditions

  • High-throughput screening to identify conditions where YfbV is essential

  • Suppressor mutation analysis to identify functional interactions

2. Evolutionary and comparative genomics:

  • Analysis of YfbV conservation across Shigellae and related Enterobacteriaceae

  • Identification of co-evolving genes suggesting functional relationships

  • Examination of selection pressure on different domains

  • Horizontal gene transfer analysis to determine evolutionary origin

3. In vivo relevance assessment:

  • Tracking YfbV expression during infection using reporter constructs

  • Competition assays between wild-type and yfbV mutants in animal models

  • Tissue-specific requirements for YfbV during different infection stages

  • Impact of host factors on YfbV function

4. Integration with systems biology:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Network analysis to position YfbV in cellular regulatory networks

  • Flux balance analysis to determine metabolic impacts of YfbV

  • Mathematical modeling of YfbV's role in stress responses

5. Advanced structural biology:

  • Cryo-EM studies of YfbV in complex with interaction partners

  • Conformational dynamics studies using hydrogen-deuterium exchange

  • In-cell structural biology to determine native conformation

  • Computational simulation of membrane integration and dynamics

6. Translational research:

  • High-throughput screening for inhibitors of YfbV function

  • Development of diagnostic approaches targeting YfbV

  • Evaluation of YfbV as a biomarker for S. flexneri infection

  • Assessment of YfbV as a target for phage-based therapeutics

7. Cross-pathogen studies:

  • Comparative analysis of UPF0208 family proteins across diverse pathogens

  • Identification of conserved functional mechanisms

  • Translation of findings from model systems to clinically relevant pathogens

  • Study of host response to UPF0208 family proteins from different bacteria

This research roadmap would provide a comprehensive understanding of YfbV biology while simultaneously advancing membrane protein research methodologies and potentially yielding new therapeutic approaches for enteric infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.