Recombinant Shigella flexneri serotype 5b UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The full-length YciC protein consists of 247 amino acids (UniProt ID: Q0T5E1) with a predicted molecular weight of approximately 27 kDa . Its sequence includes a conserved domain indicative of integral membrane localization, featuring multiple transmembrane (TM) helices . Key sequence features:

  • N-terminal region: Hydrophobic residues consistent with membrane insertion .

  • Central motif: A periplasmic loop (residues 80-120) with potential interaction sites for bacterial signaling systems .

Production and Purification

The recombinant protein is expressed in Escherichia coli systems, leveraging bacterial machinery for membrane protein biogenesis . Critical production parameters include:

ParameterDetails
Expression SystemE. coli BL21(DE3) or similar strains
TagHis-tag (N-terminal) for affinity purification
PurificationImmobilized metal affinity chromatography (IMAC)
BufferTris/PBS-based with 50% glycerol, pH 8.0
Purity>90% (verified by SDS-PAGE)

Post-purification, the protein is stored at -20°C or -80°C to preserve stability, with lyophilization as an alternative .

Applications in Research

Recombinant YciC is primarily used for:

  • Antigen production: As a component in ELISA assays to study immune responses to Shigella membrane proteins .

  • Structural biology: Crystallization trials to resolve its membrane topology .

  • Vaccine development: Though not directly tested, Shigella outer membrane vesicles (OMVs) engineered with heterologous antigens (e.g., ETEC’s LTB) demonstrate the utility of recombinant OMPs in vaccine platforms .

Comparative Analysis with Homologs

YciC homologs in Salmonella newport (UniProt ID: B4SUC3) share 84% sequence identity with Shigella YciC, highlighting evolutionary conservation . Key differences include:

FeatureShigella flexneri YciCSalmonella newport YciC
AA SequenceMSITAQSVYRDTGNFFRNQFMT... MSITAKSVYRDAGNFFRNQFIT...
Expression HostE. coli (unmodified) E. coli (His-tagged)
Storage BufferTris + 50% glycerol Tris/PBS + 6% trehalose

Challenges and Future Directions

Current limitations include:

  • Functional ambiguity: No direct links to virulence or metabolic pathways have been established .

  • Stability issues: Repeated freeze-thaw cycles degrade the protein, necessitating single-use aliquots .
    Future studies could explore YciC’s interaction with Shigella’s YfiBNR system or its role in membrane remodeling during infection .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciC; SFV_1269; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSELIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGIFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links

KEGG: sfv:SFV_1269

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella flexneri serotype 5b UPF0259 membrane protein yciC?

The yciC protein is a membrane-associated protein found in Shigella flexneri serotype 5b (strain 8401). It belongs to the UPF0259 protein family, a group of proteins with conserved sequences but incompletely characterized functions. The protein is encoded by the yciC gene (locus name SFV_1269) and represents a full-length protein spanning the expression region 1-247. The protein has been assigned the UniProt accession number Q0T5E1, facilitating standardized reference across research publications and databases . The yciC gene is located in a chromosomal region that shows significant homology to sequences found in Escherichia coli K-12, specifically in a region downstream of the tonB gene at approximately 28 minutes on the E. coli chromosome map .

How is the yciC gene functionally related to other genes in Shigella?

The yciC gene in S. flexneri is positioned in a chromosomal region that shows significant homology to sequences in E. coli K-12. Specifically, it is located downstream of the tonB gene. Research has demonstrated that a recombinant plasmid carrying the wild-type E. coli yciC-tonB region (designated pML14) can restore plaque-forming ability in certain S. flexneri mutants, suggesting functional relevance in bacterial virulence or cell-to-cell spread mechanisms . This genetic context provides important clues about potential functional relationships and regulatory networks that may influence yciC expression and activity in the bacterial cell.

What expression systems are recommended for recombinant yciC protein production?

For recombinant expression of Shigella flexneri yciC protein, researchers typically employ bacterial expression systems, particularly E. coli-based platforms. While the search results don't specify the exact expression system used for commercial production, standard approaches would include:

  • Selection of an appropriate E. coli strain (BL21(DE3), Rosetta, or similar strains optimized for membrane protein expression)

  • Cloning the full coding sequence (amino acids 1-247) into a vector with an inducible promoter (such as T7)

  • Optimization of induction conditions (temperature, inducer concentration, and duration) to maximize yield while maintaining proper folding

Expression of membrane proteins like yciC often requires specialized approaches to maintain protein solubility and proper folding. For experimental validation, researchers should compare expression in multiple host strains and under various induction conditions to identify optimal parameters for their specific research needs .

What storage conditions ensure stability of purified recombinant yciC protein?

According to product information, the recommended storage conditions for recombinant yciC protein are:

  • Primary storage: -20°C in a buffer containing Tris and 50% glycerol optimized for this specific protein

  • Extended storage: -20°C or -80°C

  • Working aliquots: 4°C for up to one week

  • Special consideration: Repeated freezing and thawing is not recommended and should be avoided

These storage recommendations reflect general principles for membrane protein stability, where glycerol serves as a cryoprotectant to prevent protein denaturation during freeze-thaw cycles . Researchers should validate protein stability using activity assays or structural integrity tests specific to their experimental applications.

What is known about the potential role of yciC in Shigella pathogenesis?

For comprehensive characterization, researchers should consider:

  • Generating targeted gene deletions or interruptions

  • Performing phenotypic analysis including invasion assays, intracellular growth, and plaque formation

  • Evaluating contribution to stress resistance, especially to conditions encountered within host cells

  • Assessing protein-protein interactions with known virulence factors

How does outer membrane protein research contribute to Shigella vaccine development?

Outer membrane proteins (OMPs) have emerged as promising vaccine candidates against Shigella and other gram-negative pathogens for several reasons:

  • Surface exposure: OMPs are surface-exposed, making them accessible to antibodies and immune effector cells

  • Conservation: Many OMPs are conserved across different serotypes, potentially providing cross-protection

  • Stability: OMPs often maintain stable conformations, which can translate to consistent immune responses

  • Reverse vaccinology applications: The reverse vaccinology approach has enabled systematic identification of OMPs with vaccine potential based on genomic and proteomic analysis

While not specifically addressing yciC, the search results indicate that other membrane proteins like TolC have demonstrated promise as vaccine candidates. A study using reverse vaccinology identified TolC as an immunogenic antigen capable of conferring protection against shigellosis in mouse models . Similar methodological approaches could be applied to evaluate yciC's potential as a vaccine candidate.

What methodological approaches are used to evaluate immunogenicity of membrane proteins like yciC?

Based on approaches described for other Shigella membrane proteins, evaluation of yciC immunogenicity would typically involve:

  • In silico analysis: Assessment of:

    • Transmembrane domains

    • Sequence conservation across strains

    • Antigenicity prediction

    • B-cell and T-cell epitope prediction using immunoinformatics tools

  • Protein expression and purification: Production of recombinant protein for immunization studies

  • Animal immunization studies: Typically using:

    • BALB/c mice as a model system

    • Multiple immunization routes (e.g., intraperitoneal)

    • Appropriate adjuvant selection

  • Immune response assessment:

    • Indirect ELISA for antibody titer determination

    • Analysis of antibody isotypes (IgG1, IgG2a)

    • T-cell response evaluation

  • Challenge studies:

    • Protection against lethal dose (LD50) of virulent Shigella

    • Bacterial burden quantification

    • Histopathological evaluation

These methodological approaches follow established protocols for vaccine candidate evaluation, as demonstrated in studies of TolC protein, which showed effective protection against shigellosis in mice .

How can recombinant Shigella membrane proteins be incorporated into novel vaccine delivery platforms?

Recent advances in vaccine delivery systems offer innovative approaches for Shigella membrane proteins. One promising strategy involves the use of outer membrane vesicles (OMVs). As demonstrated with other Shigella proteins, OMVs can serve as effective delivery vehicles that maintain the native conformation of membrane antigens while providing built-in adjuvant properties through associated pathogen-associated molecular patterns (PAMPs).

A notable example from the search results describes the development of recombinant S. flexneri strains expressing the heat-labile enterotoxin B (LTB) subunit of enterotoxigenic E. coli (ETEC) incorporated into Shigella's genome. This approach:

  • Enhances stability and consistent production of the antigen

  • Utilizes S. flexneri OMVs as antigen delivery vehicles

  • Contains multiple Shigella outer membrane proteins (including OmpA, OmpC) and virulence factors

  • Aims to provide cross-protection against both bacterial pathogens

Similar approaches could be applied to yciC, either alone or in combination with other antigens, to develop multivalent vaccine candidates that leverage the immunogenic potential of both the protein antigen and the OMV delivery system .

What analytical techniques should be employed to characterize the structure-function relationship of yciC?

Understanding the structure-function relationship of yciC requires a multidisciplinary approach combining:

  • High-resolution structural analysis:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • Nuclear magnetic resonance (NMR) for specific domains

    • Molecular dynamics simulations to predict membrane interactions

  • Functional mapping:

    • Site-directed mutagenesis of conserved residues

    • Domain deletion analysis

    • Chimeric protein construction

  • Interaction studies:

    • Pull-down assays and co-immunoprecipitation

    • Bacterial two-hybrid systems

    • Surface plasmon resonance for binding kinetics

    • Cross-linking coupled with mass spectrometry

  • Localization and trafficking:

    • Immunogold electron microscopy

    • Fluorescent protein fusions

    • Subcellular fractionation

A thorough understanding of structure-function relationships would enable rational design of yciC-based vaccine antigens or identification of regions that could be targeted for therapeutic intervention.

How might genetic variations in yciC across Shigella strains impact immunogenicity and vaccine efficacy?

Genetic variation in bacterial antigens can significantly impact vaccine development. For yciC, researchers should consider:

  • Sequence conservation analysis:

    • Multiple sequence alignment across diverse Shigella isolates

    • Identification of conserved versus variable regions

    • Epitope mapping focused on conserved regions

  • Population genetics approaches:

    • Analysis of selection pressure on different protein domains

    • Identification of immunodominant but variable regions versus conserved epitopes

    • Assessment of geographical distribution of variants

  • Cross-reactivity testing:

    • Evaluation of antibody cross-reactivity against different yciC variants

    • T-cell epitope conservation analysis

    • Cross-protection studies in animal models

While specific information about yciC variation is not provided in the search results, lessons from other bacterial vaccine development efforts suggest that focusing on conserved epitopes is crucial for broad-spectrum protection.

Technical specifications for recombinant Shigella flexneri serotype 5b UPF0259 membrane protein yciC

ParameterSpecificationNotes
UniProt AccessionQ0T5E1Reference identifier for database cross-referencing
Source organismShigella flexneri serotype 5b (strain 8401)Specific strain information important for genetic context
Gene nameyciCAnnotated gene symbol
Locus nameSFV_1269Genomic identifier
Protein length247 amino acidsFull-length protein
Expression region1-247Complete coding sequence used for expression
Storage bufferTris-based buffer with 50% glycerolOptimized for protein stability
Recommended storage-20°C (short-term), -20°C or -80°C (long-term)Avoid repeated freeze-thaw cycles
Working storage4°C for up to one weekFor active experimental use

This technical information provides essential parameters for researchers working with the recombinant protein in laboratory settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.