Recombinant Shigella flexneri serotype 5b UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

Introduction

Shigella flexneri is a Gram-negative bacterium and a prominent cause of bacillary dysentery, particularly in developing countries . With the rise of multidrug-resistant strains and the absence of a licensed vaccine, understanding the genetic mechanisms of Shigella virulence is crucial for developing new therapeutic strategies . The YfiBNR system, a tripartite signaling pathway, regulates cyclic-di-GMP (c-di-GMP) levels, influencing biofilm formation, motility, and other virulence factors . YobD, also known as YfiB, is an outer membrane protein and a key component of this system .

YfiB: An Overview

YfiB is an outer membrane protein belonging to the OmpA superfamily and is part of the YfiBNR operon system . This system is involved in modulating c-di-GMP levels in response to stress indicators detected at the periplasm .

Role in Virulence

YfiB plays a significant role in the virulence of Shigella flexneri . It influences multiple cellular processes, including:

  • Biofilm formation

  • Bacterial invasion

  • Host-surface attachment

Knocking out the yfiB gene disrupts the YfiBNR system, leading to decreased c-di-GMP levels and reduced virulence .

YfiBNR System

The YfiBNR system is a tripartite signaling pathway that regulates c-di-GMP levels within bacterial cells . C-di-GMP is a secondary messenger molecule that affects various cellular processes, including biofilm formation, exopolysaccharide synthesis, cytotoxicity, motility, adhesion, and invasion . YfiB modulates the activity of YfiN, a diguanylate cyclase (DGC), which synthesizes c-di-GMP .

Shigella flexneri Serotypes and O-Antigen

Shigella flexneri has multiple serotypes, with at least 23 reported . The serotypes are determined by the structure of the O-antigen, a surface polysaccharide . Modifications to the O-antigen, such as the addition of glucosyl, O-acetyl, or phosphoethanolamine (pEtN), lead to serotype conversion .

Protein Expression during Growth Phases

The expression of various proteins in Shigella flexneri changes during the transition from exponential growth to the stationary phase . For example, the outer membrane protein YciD (OmpW) is almost undetectable during exponential growth but becomes highly abundant in the stationary phase .

Quantitative Proteomic Analysis

Quantitative proteomic analysis of Shigella flexneri has identified thousands of proteins, including many outer membrane and periplasmic proteins . These analyses contribute to understanding the protein composition of Shigella and its mechanisms of pathogenesis .

YidB Protein Structure

The structure of YidB protein from Shigella flexneri has been determined, revealing a new fold with a homeodomain motif .

Antibody Response to Shigella Antigens

In monkeys challenged with virulent Shigella flexneri, serum antibody responses to proteins encoded by the virulence-associated plasmid were observed . Convalescent sera showed a significant increase in antibody titer against proteins from a plasmid-carrying, virulent strain .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yobD; SFV_1409; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRIPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSGNAANLLI
Uniprot No.

Target Background

Database Links

KEGG: sfv:SFV_1409

Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the key considerations for purifying recombinant YobD protein while maintaining its native conformation?

Purification of membrane proteins like YobD requires specialized approaches to maintain protein stability and native conformation. A multi-step purification strategy typically involves: (1) Careful membrane solubilization using detergents such as n-dodecyl-β-D-maltoside (DDM), lauryldimethylamine-N-oxide (LDAO), or digitonin, which must be optimized to effectively extract YobD without denaturing it; (2) Initial purification via affinity chromatography using an appropriate tag (His-tag, FLAG-tag, etc.); (3) Size exclusion chromatography to separate monomeric from aggregated protein; and (4) Verification of protein conformation using circular dichroism to confirm secondary structure integrity . When purifying recombinant membrane proteins from Shigella, researchers have found that maintenance of the protein in its soluble form requires careful optimization of buffer conditions throughout the purification process. This may include screening different detergent concentrations, pH values, and salt concentrations to identify conditions that maintain YobD stability . Quality control using analytical techniques such as dynamic light scattering can help verify the monodispersity of the purified protein preparation.

What structural analysis techniques are most informative for characterizing YobD protein?

Comprehensive structural characterization of YobD requires a multi-technique approach. X-ray crystallography remains the gold standard for high-resolution structural determination, though membrane proteins present significant crystallization challenges. Researchers should consider lipidic cubic phase crystallization methods that have proven successful for other membrane proteins. Cryo-electron microscopy (cryo-EM) offers an alternative approach that doesn't require crystallization and is increasingly capable of near-atomic resolution for membrane proteins. Nuclear magnetic resonance (NMR) spectroscopy can provide valuable information about protein dynamics and ligand interactions, particularly for specific domains of the protein . Computational approaches, including AlphaFold prediction (as seen with the existing model AF_AFB7L6U8F1), provide valuable starting points but should be validated experimentally . Circular dichroism spectroscopy can confirm the predicted secondary structure composition, which for YobD likely includes significant α-helical content based on its membrane protein nature. Finally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into protein dynamics and solvent accessibility of different protein regions.

How can researchers investigate potential protein-protein interactions involving YobD?

Investigating protein-protein interactions involving YobD requires both in vivo and in vitro approaches. Co-immunoprecipitation using YobD-specific antibodies followed by mass spectrometry can identify protein binding partners in native conditions. Bacterial two-hybrid systems adapted for membrane proteins can screen for potential interactions in a cellular context. For in vitro studies, techniques such as surface plasmon resonance (SPR), microscale thermophoresis (MST), or biolayer interferometry can quantify binding affinities between purified YobD and potential interacting partners . Cross-linking mass spectrometry (XL-MS) can capture transient interactions and map interaction interfaces with amino acid resolution. Learning from studies on Ipa proteins, researchers should examine if YobD participates in high-molecular-weight protein complexes that may be essential for its function . Differential protein expression analysis comparing wild-type and yobD knockout strains can also reveal functional networks affected by YobD, potentially identifying interaction partners indirectly.

What methods are appropriate for studying the membrane topology and integration of YobD?

Understanding the membrane topology of YobD is crucial for functional characterization. Several complementary methods should be employed: (1) Protease protection assays, where proteases are added to intact cells, spheroplasts, or inverted membrane vesicles to determine which protein regions are accessible; (2) Substituted cysteine accessibility method (SCAM), where single cysteines are introduced throughout the protein and then probed with membrane-impermeant sulfhydryl reagents; (3) Fluorescence microscopy using GFP fusions to different termini of the protein to determine their cellular localization; and (4) Alkaline phosphatase or β-lactamase fusion reporters that have different activities depending on whether they face the cytoplasm or periplasm . Computational prediction tools like TMHMM, Phobius, or TOPCONS can provide initial models of transmembrane segments, but these should be validated experimentally. For detailed analysis, site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy can provide information about the dynamics and environment of specific amino acid residues within the membrane.

How might YobD contribute to Shigella flexneri pathogenesis?

While the specific role of YobD in Shigella flexneri pathogenesis remains to be fully characterized, several hypotheses can be investigated based on knowledge of bacterial membrane proteins and Shigella pathogenesis. YobD may participate in: (1) Maintaining membrane integrity during host cell invasion; (2) Facilitating interactions with host cell receptors; (3) Contributing to type III secretion system (T3SS) function, which is critical for Shigella virulence; or (4) Participating in stress response mechanisms during infection . To investigate these possibilities, researchers should develop knockout and complementation strains to assess changes in bacterial fitness, invasion capacity, and virulence in cellular and animal models. Transcriptomic and proteomic analyses comparing gene expression profiles between wild-type and yobD mutant strains during infection can identify pathways affected by YobD deletion. Additionally, localization studies during different stages of infection can provide insights into whether YobD redistributes within the bacterial membrane during critical pathogenesis steps, potentially indicating functional roles during specific infection stages.

What experimental approaches can determine if YobD interacts with components of the type III secretion system?

The type III secretion system (T3SS) is crucial for Shigella pathogenesis, mediating the secretion of effector proteins such as IpaB, IpaC, and IpaD that enable epithelial cell invasion . To investigate potential interactions between YobD and T3SS components, researchers should consider: (1) Co-immunoprecipitation studies using antibodies against known T3SS components to determine if YobD co-precipitates; (2) Bacterial two-hybrid assays specifically targeting T3SS proteins as potential interaction partners; (3) Fluorescence microscopy with differentially labeled YobD and T3SS components to assess co-localization patterns; and (4) Genetic approaches examining whether yobD mutations affect T3SS assembly or function . Functional assays measuring secretion efficiency of known T3SS substrates in wild-type versus yobD-deficient strains can provide indirect evidence of functional relationships. Additionally, structural biology approaches such as cryo-electron tomography of bacterial membranes may visualize spatial relationships between YobD and T3SS apparatus in situ. Crosslinking experiments followed by mass spectrometry analysis can identify direct protein-protein contacts between YobD and T3SS components at the molecular level.

How can researchers differentiate the role of YobD from other membrane proteins in Shigella flexneri?

Differentiating the specific functions of YobD from other membrane proteins requires precise genetic and biochemical approaches. Researchers should develop: (1) Clean deletion and complementation systems for yobD with minimal polar effects on nearby genes; (2) Domain-swapping experiments with homologous proteins to identify function-specific regions; (3) Site-directed mutagenesis targeting conserved residues to pinpoint crucial amino acids for function; and (4) Conditional expression systems to study temporal aspects of YobD function . Comparative phenotypic analysis across multiple membrane protein mutants can highlight unique versus redundant functions. Multi-omics approaches (transcriptomics, proteomics, metabolomics) comparing wild-type, yobD mutant, and mutants of other membrane proteins can reveal distinct molecular signatures associated with each protein. For definitive functional assignment, researchers should develop specific biochemical assays based on predicted functions (e.g., testing for transporter activity if YobD is hypothesized to transport specific molecules). Finally, heterologous expression of YobD in surrogate bacterial hosts lacking similar proteins can help isolate its function from the complex genetic background of Shigella.

What advanced genetic engineering techniques are most appropriate for studying YobD function in Shigella?

Modern genetic tools enable sophisticated manipulation of yobD to elucidate its function. CRISPR-Cas9 genome editing offers precise engineering capabilities for creating clean deletions, point mutations, or tagged versions of yobD at its native locus. Inducible expression systems such as tetracycline-responsive promoters allow temporal control of YobD expression to study its role during different stages of infection. For spatial studies, researchers should consider fluorescent protein fusions that maintain protein function while enabling visualization . Advanced approaches include: (1) Rapidly degradable YobD variants using degron tags to study acute loss of function; (2) Split protein complementation systems to visualize and quantify protein-protein interactions in vivo; (3) Conditional promoter trap systems to identify conditions that modulate yobD expression; and (4) Dual-reporter systems to simultaneously monitor yobD expression and bacterial physiological states during infection . Additionally, transposon-sequencing (Tn-seq) comparing fitness contributions of yobD versus other genes under various stress conditions can provide insights into its contextual importance. For precise amino acid-level functional mapping, deep mutational scanning approaches can systematically evaluate the effect of all possible amino acid substitutions on YobD function.

What experimental design considerations are crucial when evaluating YobD's potential role in bacterial stress response?

Evaluating YobD's role in stress response requires systematic experimental approaches. Researchers should design experiments that: (1) Expose wild-type and yobD mutant strains to diverse stressors relevant to host environments (pH shifts, oxidative stress, antimicrobial peptides, bile salts, temperature fluctuations); (2) Measure survival rates, growth kinetics, and morphological changes under each condition; (3) Include time-course analyses to distinguish immediate versus adaptive responses; and (4) Employ appropriate controls, including complemented strains and strains with mutations in known stress response proteins . Advanced experimental designs should incorporate: (1) Competition assays where wild-type and mutant strains compete in the same environment to detect subtle fitness differences; (2) Fluctuating stress conditions that mimic transitions bacteria experience during infection; (3) Single-cell analysis techniques to identify potential heterogeneity in stress responses; and (4) Integrative multi-omics approaches to connect phenotypic observations with molecular mechanisms. For rigorous statistical analysis, researchers should use appropriate switchback experimental designs when evaluating time-dependent stress responses to control for carryover effects from previous treatments . Additionally, microfluidic systems enabling precise control of microenvironments combined with time-lapse microscopy can provide insights into the dynamics of YobD localization and expression during stress exposure.

How should researchers design immunological studies to evaluate the potential of YobD as a vaccine antigen?

Evaluating YobD as a potential vaccine antigen requires systematic immunological studies. Initially, researchers should: (1) Assess YobD conservation across Shigella serotypes and strains to determine breadth of potential protection; (2) Evaluate YobD expression levels and accessibility during infection using immunofluorescence microscopy and flow cytometry; (3) Determine immunogenicity by measuring antibody responses in infected or immunized animal models; and (4) Characterize epitope specificity using epitope mapping techniques . For advanced vaccine development, researchers should design studies that: (1) Compare different antigen formulations (recombinant protein, DNA vaccines, viral vectors, attenuated strains expressing modified YobD); (2) Evaluate various adjuvant combinations to optimize immune response quality; (3) Assess both humoral and cell-mediated immune responses through comprehensive immunophenotyping; and (4) Conduct challenge studies in appropriate animal models to determine protective efficacy . Drawing from successful approaches with IpaB/IpaD fusion proteins, researchers might explore creating fusion constructs incorporating YobD with other protective antigens to enhance immunogenicity and simplify vaccine formulation . Additionally, researchers should characterize the immunological memory induced by YobD immunization through long-term studies examining durability of protection and immune recall upon challenge.

What statistical approaches are recommended for analyzing complex data sets from YobD functional studies?

Analyzing complex data from YobD functional studies requires sophisticated statistical approaches. For experiments with multiple variables and time points, researchers should employ mixed-effects models that account for both fixed effects (experimental conditions) and random effects (biological variability) . When analyzing high-dimensional data such as proteomics or transcriptomics, appropriate dimensionality reduction techniques (PCA, t-SNE, UMAP) should be applied before downstream analysis. For time-series experiments, researchers should consider: (1) Time-course differential expression analysis methods that account for temporal dependencies; (2) Switchback experimental designs to control for carryover effects between sequential treatments; and (3) Autocorrelation analysis to identify cyclical patterns in YobD expression or function . For reproducibility, researchers must implement rigorous quality control measures including normalization procedures appropriate to each data type, batch effect correction, and multiple testing correction for high-dimensional data. Power analysis should be conducted a priori to ensure sufficient sample sizes for detecting biologically meaningful effects. When integrating multiple data types, researchers should consider Bayesian network approaches or multi-block statistical methods that can identify relationships across different molecular layers while accounting for the unique statistical properties of each data type.

How can researchers assess and ensure the quality of recombinant YobD protein preparations?

Quality assessment of recombinant YobD preparations is critical for reliable experimental outcomes. A comprehensive quality control protocol should include: (1) Purity assessment via SDS-PAGE with Coomassie and silver staining, with acceptance criteria of >95% purity; (2) Western blot analysis using anti-YobD antibodies to confirm identity; (3) Mass spectrometry to verify the exact molecular weight and detect any post-translational modifications; and (4) Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess monodispersity and oligomeric state . For membrane proteins like YobD, researchers should additionally evaluate: (1) Proper folding using circular dichroism to confirm expected secondary structure composition; (2) Thermal stability using differential scanning fluorimetry to identify buffer conditions that maximize protein stability; (3) Functionality using activity assays specific to predicted functions; and (4) Long-term stability under storage conditions using accelerated stability testing protocols . When YobD is intended for structural studies, cryo-EM negative staining can provide visual confirmation of sample quality and homogeneity. For immunological studies, endotoxin testing is essential, with acceptance limits typically <0.1 EU/μg protein. Researchers should establish standardized quality control checkpoints throughout the purification process with clear pass/fail criteria to ensure batch-to-batch consistency.

What strategies can address challenges in reproducibility when working with recombinant membrane proteins like YobD?

Reproducibility challenges with membrane proteins require systematic troubleshooting approaches. Researchers should implement: (1) Detailed standard operating procedures (SOPs) documenting every step from gene sequence verification to final protein characterization; (2) Critical parameter testing to identify variables most affecting reproducibility (e.g., bacterial growth phase at induction, detergent lot variability); (3) Reference standard creation where a well-characterized batch serves as a comparator for new preparations; and (4) Multi-site validation studies for critical findings . To minimize batch-to-batch variability, researchers should consider: (1) Using automated liquid handling systems for key purification steps; (2) Implementing statistical process control with defined acceptance criteria at each purification stage; (3) Employing design of experiments (DoE) methodology to systematically optimize expression and purification conditions; and (4) Developing quantitative functional assays with clear performance metrics . For complex protocols, researchers should create decision trees to guide troubleshooting when deviations occur. Additionally, establishing biobanking protocols for successful preparations (including detailed documentation of preparation methods and quality control results) ensures availability of consistent material for extended studies. Finally, researchers should consider adopting open science practices such as protocol sharing via platforms like protocols.io to enhance method standardization across laboratories.

What are the most promising approaches for resolving contradictory data regarding YobD function?

When faced with contradictory data regarding YobD function, researchers should implement systematic resolution strategies. First, conduct a comprehensive meta-analysis of existing studies, categorizing results by experimental conditions, genetic backgrounds, and methodological approaches to identify patterns explaining discrepancies. Design definitive experiments that: (1) Directly test competing hypotheses under identical conditions; (2) Employ multiple complementary techniques to measure the same parameter; (3) Include positive and negative controls that can validate assay performance; and (4) Utilize genetic approaches such as suppressor mutations or synthetic lethality screens to clarify functional pathways . Collaborative multi-laboratory studies using standardized materials and protocols can distinguish reproducible findings from lab-specific artifacts. For mechanistic controversies, structural biology approaches providing molecular-level insights can often resolve functional debates. Time-resolved studies may reconcile apparently contradictory data by revealing that YobD serves different functions at different stages of the bacterial life cycle or infection process. Finally, systems biology approaches integrating multiple data types (genomics, transcriptomics, proteomics, metabolomics) can provide a more holistic view of YobD function within broader cellular networks, potentially reconciling seemingly disparate observations by placing them in a broader biological context.

How can high-throughput screening approaches be adapted to identify small molecule modulators of YobD function?

Adapting high-throughput screening (HTS) for identifying YobD modulators requires innovative approaches suitable for membrane proteins. Researchers should develop: (1) Cell-based reporter assays where YobD function is coupled to easily detectable outputs such as fluorescence or luminescence; (2) In vitro assays using purified protein to measure specific biochemical activities or conformational changes; (3) Binding assays such as thermal shift assays or surface plasmon resonance adapted to microplate format; and (4) Phenotypic screens measuring Shigella virulence properties presumed to depend on YobD function . Fragment-based screening approaches are particularly valuable for membrane proteins, as they can identify binding hotspots even when protein function is not fully characterized. For target validation, researchers should develop YobD variants with mutations in potential small molecule binding sites and test whether these mutations confer resistance to identified modulators. Computational approaches including virtual screening and molecular dynamics simulations can complement experimental HTS by prioritizing compounds for testing and predicting binding modes. To enhance screening efficiency, researchers should implement machine learning algorithms trained on initial screening data to predict additional active compounds from larger virtual libraries. Following hit identification, medicinal chemistry optimization should focus on improving potency while enhancing properties relevant for anti-bacterial compounds (stability, membrane permeability, resistance to efflux pumps).

What interdisciplinary approaches might yield new insights into YobD structure-function relationships?

Interdisciplinary approaches combining multiple scientific disciplines can provide transformative insights into YobD biology. Researchers should consider integrating: (1) Synthetic biology approaches to create YobD variants with altered or enhanced functions; (2) Advanced imaging techniques such as super-resolution microscopy and correlative light-electron microscopy to visualize YobD distribution and dynamics in unprecedented detail; (3) Computational biology methods including molecular dynamics simulations to predict conformational changes and molecular interactions; and (4) Systems biology approaches to position YobD within bacterial regulatory and protein interaction networks . Emerging technologies that could yield new insights include: (1) Cryo-electron tomography to visualize YobD in its native membrane environment; (2) Native mass spectrometry to capture intact membrane protein complexes; (3) Microfluidics combined with live-cell imaging to study YobD dynamics during host-cell infection in controlled microenvironments; and (4) Single-molecule techniques to observe conformational dynamics of individual YobD molecules . Cross-species comparative studies examining YobD homologs in related bacteria can illuminate conserved functional mechanisms and species-specific adaptations. Finally, interdisciplinary collaborations between structural biologists, immunologists, and vaccine developers could accelerate translation of basic YobD research into therapeutic applications, as demonstrated by the successful integration of structural and immunological approaches in developing the IpaB-IpaD fusion vaccine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.