Recombinant Shigella flexneri serotype 5b UPF0283 membrane protein YcjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; SFV_1338; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVEQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGIQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTVRLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links

KEGG: sfv:SFV_1338

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YcjF protein and what is its basic structure?

YcjF is a UPF0283 family membrane protein found in Shigella flexneri serotype 5b. The full-length protein consists of 353 amino acids with a molecular structure that includes multiple membrane-spanning regions and a C-terminus facing the cytoplasmic side. The protein's amino acid sequence is: MTEPLKPRIDFDGPLEVEQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAALRPKRSLWRKMVMGGLALFGASVVGQGIQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVVTEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHETQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLINRIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIGAGLLTVRLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK . The protein contains characteristic hydrophobic regions typical of membrane proteins, allowing it to anchor effectively in the bacterial cell membrane.

How does YcjF compare with other membrane proteins in gram-negative bacteria?

YcjF belongs to the UPF0283 family of membrane proteins found across various gram-negative bacteria. Unlike better-characterized membrane proteins involved in transport or signaling, YcjF's precise natural function remains less defined. When compared to other membrane proteins in Shigella and related Enterobacteriaceae, YcjF shows distinct properties that make it particularly useful as a membrane anchor in recombinant protein expression systems. Among various membrane anchors tested for fusion protein applications, YcjF variants demonstrated superior performance, especially when the C-terminus faces the cytoplasmic site . This suggests unique structural properties that may facilitate proper folding and orientation of recombinant fusion partners.

How effective is YcjF as a fusion partner for recombinant protein expression?

YcjF has demonstrated significant effectiveness as a fusion partner, particularly for expressing challenging membrane proteins such as cytochrome P450s. In comparative studies, fusions with the YcjF variant resulted in notably increased expression levels compared to other bacterial membrane anchors. The structural arrangement where the C-terminus faces the cytoplasmic site appears to be particularly advantageous for proper folding and functional expression .

When designing fusion constructs with YcjF, researchers should consider:

  • The orientation of the fusion (N-terminal vs. C-terminal fusions)

  • The presence of appropriate linker sequences

  • The compatibility with downstream purification methods

  • The impact on the target protein's folding and function

Studies have shown that YcjF fusions can enhance expression levels while maintaining the functional properties of the partner protein, making it a valuable tool for difficult-to-express recombinant proteins in bacterial systems .

What are the optimal conditions for expressing recombinant YcjF protein?

Optimal expression of recombinant YcjF protein requires careful consideration of several experimental parameters. Based on standard protocols for membrane proteins and specific information about YcjF:

  • Expression host: E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Growth temperature: Lower temperatures (16-25°C) often improve proper folding

  • Induction conditions: Lower IPTG concentrations (0.1-0.5 mM) and longer induction times

  • Media composition: Rich media supplemented with appropriate cofactors

For storage and handling, the recombinant protein is typically maintained in Tris-based buffer with 50% glycerol to ensure stability. For long-term storage, the protein should be kept at -20°C or -80°C, with repeated freeze-thaw cycles avoided to preserve activity . Working aliquots can be stored at 4°C for up to one week to minimize degradation while maintaining accessibility for experiments.

What techniques are most effective for analyzing YcjF structure-function relationships?

Multiple complementary approaches are recommended for comprehensive analysis of YcjF structure-function relationships:

  • Computational analysis: Prediction of transmembrane domains and topology using algorithms like TMHMM, HMMTOP, and PredictProtein.

  • Biochemical approaches:

    • Protease protection assays to determine membrane topology

    • Site-directed spin labeling combined with EPR spectroscopy

    • Cross-linking studies to identify interacting domains

  • Structural biology methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for specific domains

  • Functional studies:

    • Mutagenesis combined with functional assays

    • Chimeric protein analysis to identify critical domains

    • In vivo complementation studies

How can researchers optimize purification protocols for recombinant YcjF?

Purification of membrane proteins like YcjF presents unique challenges requiring specialized protocols:

  • Membrane extraction: Use mild detergents (n-dodecyl-β-D-maltoside, CHAPS, or digitonin) for initial solubilization. Start with detergent screening to identify optimal conditions that maintain protein stability and function.

  • Affinity chromatography: If expressed with affinity tags (His, FLAG, etc.), use appropriate affinity resins. Consider placing tags at the C-terminus, as it faces the cytoplasmic side and is likely more accessible.

  • Size exclusion chromatography: Important for removing aggregates and ensuring homogeneity.

  • Buffer optimization:

    ComponentRecommended RangePurpose
    pH7.0-8.0Maintain native structure
    Salt150-300 mM NaClPrevent nonspecific interactions
    Glycerol10-50%Enhance stability
    Detergent1-2× CMCMaintain solubility
    Reducing agent1-5 mM DTT or 2-10 mM β-MEPrevent oxidation
  • Quality assessment: Use multiple methods (SDS-PAGE, Western blot, dynamic light scattering, circular dichroism) to evaluate protein purity, homogeneity, and folding.

For long-term storage, the purified protein should be maintained in a Tris-based buffer with 50% glycerol . Avoid repeated freeze-thaw cycles by preparing single-use aliquots stored at -80°C.

What is known about YcjF's role in Shigella flexneri pathogenesis?

While the specific role of YcjF in Shigella flexneri pathogenesis is not fully characterized in the available literature, we can draw insights from studies of related proteins and Shigella virulence mechanisms. Shigella flexneri's pathogenicity depends critically on the type III secretion system (T3SS) and various regulatory proteins .

Membrane proteins often play important roles in bacterial virulence by:

  • Facilitating host cell adhesion and invasion

  • Participating in secretion systems

  • Maintaining membrane integrity during infection

  • Responding to environmental cues in the host

Further research using gene knockout studies, transcriptomics during infection, and protein-protein interaction analyses would help elucidate YcjF's specific contributions to Shigella pathogenesis.

How does YcjF interact with other Shigella flexneri proteins?

While specific protein-protein interactions involving YcjF are not directly described in the provided literature, we can suggest methodological approaches to investigate these interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against YcjF to pull down potential interacting partners, followed by mass spectrometry identification.

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect interactions in the context of the bacterial membrane.

  • Cross-linking mass spectrometry: To capture transient or weak interactions within the native membrane environment.

  • Proximity labeling approaches: Such as BioID or APEX2 fused to YcjF to identify proteins in its vicinity.

Research on Shigella virulence has identified important regulatory networks, including transcriptional regulators like YhjC that activate virF expression . While this is a different protein than YcjF, it illustrates the complex regulatory networks in Shigella that might involve membrane proteins like YcjF. Investigation of potential connections between YcjF and known virulence factors would be a valuable research direction.

How can YcjF be utilized in heterologous protein expression systems?

YcjF has demonstrated significant utility in heterologous protein expression systems, particularly for challenging membrane proteins:

  • Fusion protein design: YcjF can be used as a membrane anchor for expressing difficult proteins. When fused to plant cytochrome P450 CYP79A1, YcjF variants showed superior performance compared to other membrane anchors, particularly when the C-terminus faced the cytoplasmic site .

  • Expression optimization strategies:

    • Bicistronic expression systems where YcjF fusion and partner proteins are expressed from the same promoter

    • Dual-plasmid systems for independent control of expression levels

    • Inducible promoter systems for temporal control

  • Applications in metabolic engineering:

    • Integration of YcjF fusions into metabolic pathways requiring membrane-associated enzymes

    • Enhancement of substrate channeling for multi-enzyme reactions

    • Improvement of enzyme stability and activity in industrial bioprocesses

  • Structural biology applications:

    • Using YcjF as a stabilizing partner for crystallization of membrane proteins

    • Enhancing expression levels for structural studies requiring large protein quantities

These approaches have been successfully employed with cytochrome P450 enzymes, suggesting broader applicability to other challenging membrane proteins .

What are the implications of YcjF research for antimicrobial development?

Research on YcjF and related membrane proteins in Shigella flexneri has several potential implications for antimicrobial development:

  • Novel target identification: As a membrane protein potentially involved in pathogenesis, YcjF might represent a novel target for antimicrobial development. Understanding its structure and function could reveal druggable sites.

  • Virulence factor inhibition: If YcjF plays a role in Shigella virulence (directly or indirectly), inhibitors could potentially attenuate pathogenicity without directly killing bacteria, potentially reducing selective pressure for resistance.

  • Diagnostic applications: Antibodies or other detection methods targeting YcjF could be developed for rapid identification of Shigella flexneri infections.

  • Vaccine development: If YcjF is exposed on the bacterial surface, it might serve as an antigen for vaccine development efforts.

What are common challenges in working with recombinant YcjF and how can they be addressed?

Working with membrane proteins like YcjF presents several technical challenges:

  • Low expression yields:

    • Solution: Optimize expression conditions by testing different E. coli strains, lower induction temperatures (16-25°C), and reduced inducer concentrations.

    • Consider specialized expression vectors designed for membrane proteins.

    • Explore fusion strategies with well-expressed partners like MBP or SUMO.

  • Protein misfolding and aggregation:

    • Solution: Include appropriate chaperones in expression systems.

    • Test various detergents for membrane extraction and protein solubilization.

    • Consider expression in specialized strains overexpressing membrane protein folding chaperones.

  • Protein instability:

    • Solution: Store in stabilizing buffers containing 50% glycerol .

    • Add protease inhibitors during purification and handling.

    • Minimize freeze-thaw cycles by preparing single-use aliquots.

  • Functional assessment difficulties:

    • Solution: Develop robust activity assays specific to YcjF or its fusion partners.

    • Use multiple complementary techniques to confirm proper folding.

    • Consider biophysical techniques like circular dichroism to assess secondary structure.

  • Crystallization challenges:

    • Solution: Screen multiple detergents and lipidic cubic phase methods.

    • Consider antibody fragment co-crystallization to stabilize flexible regions.

    • Explore cryo-EM as an alternative structural determination method.

Each of these challenges requires systematic troubleshooting and optimization for the specific research context and available resources.

How can researchers effectively analyze YcjF interactions with the membrane environment?

Analyzing YcjF interactions with the membrane environment requires specialized techniques:

  • Membrane topology mapping:

    • PhoA/LacZ fusion analysis to determine transmembrane segment orientation

    • Cysteine scanning mutagenesis combined with accessibility assays

    • Computational prediction tools validated by experimental data

  • Lipid interaction studies:

    • Fluorescence resonance energy transfer (FRET) between labeled YcjF and membrane lipids

    • Differential scanning calorimetry to measure thermal stability in various lipid environments

    • Native mass spectrometry to identify specifically bound lipids

  • Molecular dynamics simulations:

    • All-atom simulations of YcjF in model membranes

    • Coarse-grained simulations for longer timescale phenomena

    • Integration of experimental constraints with computational models

  • Artificial membrane systems:

    SystemAdvantagesApplications for YcjF Research
    LiposomesSimple preparation, variable compositionFunction in different lipid environments
    NanodiscsDefined size, accessible to solutionStructural studies, binding assays
    BicellesCompatible with NMR, intermediate sizeNMR structural studies of YcjF
    GUVsVisualization by microscopyLocalization studies, lateral distribution
  • In vivo membrane interaction studies:

    • Fluorescent protein fusions to visualize membrane localization

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • Super-resolution microscopy to determine nanoscale organization

These approaches provide complementary information about how YcjF integrates into membranes, which is crucial for understanding both its natural function and applications in recombinant protein expression.

What is the relationship between YcjF and Shigella flexneri virulence mechanisms?

While direct evidence linking YcjF to Shigella flexneri virulence is not explicitly provided in the available literature, we can analyze potential relationships by considering known virulence mechanisms:

  • Virulence regulation network:
    Shigella virulence is regulated by a cascade of factors, with VirF serving as a master regulator essential for the expression of Type III Secretion System (T3SS) genes . While YcjF is not directly mentioned in this cascade, membrane proteins often play roles in sensing environmental conditions that trigger virulence gene expression.

  • Potential indirect contributions:

    • Membrane integrity and adaptation during host invasion

    • Potential involvement in stress responses during infection

    • Possible roles in metabolic adaptation to the host environment

  • Comparative analysis with known virulence factors:
    Shigella flexneri has distinctive biochemical properties that contribute to its pathogenicity, including being non-motile, catalase-positive, and oxidase-negative . These properties reflect adaptations to its infectious lifestyle, potentially involving membrane proteins like YcjF.

  • Research approaches to explore connections:

    • Transcriptomic analysis of ycjF expression during infection

    • Construction and characterization of ycjF deletion mutants

    • Interaction studies with known virulence factors

    • Comparative genomics across Shigella strains with varying virulence

The study of YhjC (a different regulator) has shown how previously uncharacterized proteins can be revealed as important virulence regulators in Shigella , suggesting that similar investigations of YcjF could yield valuable insights into its potential role in pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.